DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF167 and SPAC57A7.09

DIOPT Version :9

Sequence 1:NP_001357232.1 Gene:RNF167 / 26001 HGNCID:24544 Length:374 Species:Homo sapiens
Sequence 2:NP_593372.1 Gene:SPAC57A7.09 / 2542187 PomBaseID:SPAC57A7.09 Length:372 Species:Schizosaccharomyces pombe


Alignment Length:246 Identity:61/246 - (24%)
Similarity:101/246 - (41%) Gaps:57/246 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    86 LLRRFDCNFDLKVLNAQKAGYGAAVV---HNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEY 147
            |::|..|.:..|.|.||:.|:...:|   .:.:|..|..||...:..:.::.|||:|:...|...
pombe   146 LVQRGKCTYFDKALEAQRLGFKGVIVGDNRSPSSFRLHYMVAPDKVDESKVHIPSLFVSTSSYNL 210

Human   148 LRA--LFVYEKGARVLLVPDNTFPLGYYLIPFTGIVGLLVLAMGAVMI--ARCIQHRKRLQRNRL 208
            |.:  |..|.:..::...|:.   ||....||     ||..:...:|:  .:.:..||.::..| 
pombe   211 LWSDLLHSYRQPLKLYAKPEE---LGDMFWPF-----LLCFSPSIIMLITVQALAIRKFIRTYR- 266

Human   209 TKEQLKQIPTHDYQKALNSSMFCPDLILPTCLISSTGFVGDQYDV-------------------- 253
            ||.:.::              |..|  ||:..||..||..::.::                    
pombe   267 TKSKTRR--------------FIED--LPSRTISREGFYSEEEEIENSTQNGELVPLMDESTRRA 315

Human   254 -----CAICLDEYEDGDKLRVLPCAHAYHSRCVDPWLTQTRKTCPICKQPV 299
                 |.|||:.:..|||:..|||.|.:|..|:..|:...|..||.|...|
pombe   316 TFGVECVICLESFTKGDKVVALPCKHEFHRPCIAKWIVDYRHACPTCNTEV 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF167NP_001357232.1 PA_C_RZF_like 20..170 CDD:239038 22/88 (25%)
RING-H2_RNF167 252..297 CDD:319711 18/69 (26%)
RING-H2 finger (C3H2C3-type) 254..295 CDD:319711 17/40 (43%)
SPAC57A7.09NP_593372.1 COG5540 1..369 CDD:227827 61/246 (25%)
Peptidases_S8_S53 <144..211 CDD:299169 18/64 (28%)
zf-RING_2 320..362 CDD:290367 17/41 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4628
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I2082
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm53615
orthoMCL 1 0.900 - - OOG6_103040
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X670
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.