DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF167 and C18B12.4

DIOPT Version :9

Sequence 1:NP_001357232.1 Gene:RNF167 / 26001 HGNCID:24544 Length:374 Species:Homo sapiens
Sequence 2:NP_510498.1 Gene:C18B12.4 / 181600 WormBaseID:WBGene00007666 Length:456 Species:Caenorhabditis elegans


Alignment Length:306 Identity:88/306 - (28%)
Similarity:132/306 - (43%) Gaps:50/306 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    33 NASMDFADLPALFGATLSQEGLQGFLVEAHPDNACSPIAPPPPAPVNGSVFIALLRRFD----CN 93
            |..||.:|.      .:|:|.| |..|...|.:||.|:..............|.:.|.:    |.
 Worm    52 NFGMDVSDF------IISEENL-GCGVGVEPVDACGPVRIAQNHTTRCHNLFAFVSRSNISHPCK 109

Human    94 FDLKVLNAQKAGYGAAVV--HNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYLRALFVYEK 156
            |..:....|.:.|...:|  :|....|.::|  ...|::.::.||.:.|.....|.:...|....
 Worm   110 FSHQAFMVQNSTYPFRLVIFYNYPGQEPISM--EGTELRDKVNIPVLMISHACKEEIAKKFSDTA 172

Human   157 GARV-LLVPDNTFPLGYYLIPFTGIVGLLVLAMGAVMIARCIQ---HRKRLQRNRLTKEQLKQIP 217
            |.|: :.:....:.|..|||||..::   |......:|..|::   .|::|.:.||:|..||:||
 Worm   173 GYRLRVRIDPGYYELFRYLIPFLVVI---VFCFALFLITLCVRGCVERRKLNKRRLSKRNLKKIP 234

Human   218 THDYQKALNSSMFCPDLILPTCLISSTGFVGDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVD 282
            ...|:                        :||..|.|||||:.:..|:|||.|||.|.:|..|:|
 Worm   235 VKKYR------------------------LGDDPDTCAICLESFASGEKLRHLPCRHVFHCNCID 275

Human   283 PWLTQTRKTCPICKQPVHRGPGDEDQEEETQGQEEGDEGEPRDHPA 328
            .|||||||.||:||:.:..   |.|.|..|.......:| |.|..|
 Worm   276 VWLTQTRKICPLCKRKIGT---DSDSECSTNDLASTSQG-PNDATA 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF167NP_001357232.1 PA_C_RZF_like 20..170 CDD:239038 31/143 (22%)
RING-H2_RNF167 252..297 CDD:319711 27/44 (61%)
RING-H2 finger (C3H2C3-type) 254..295 CDD:319711 25/40 (63%)
C18B12.4NP_510498.1 PA <74..176 CDD:333703 21/103 (20%)
HRD1 <223..>335 CDD:227568 46/123 (37%)
RING-H2_RNF103 246..291 CDD:319387 27/44 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I6450
eggNOG 1 0.900 - - E1_KOG4628
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41046
Inparanoid 1 1.050 142 1.000 Inparanoid score I3469
Isobase 1 0.950 - 0 Normalized mean entropy S4419
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001489
OrthoInspector 1 1.000 - - otm15079
orthoMCL 1 0.900 - - OOG6_103040
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X670
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.670

Return to query results.
Submit another query.