DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF167 and rnf167

DIOPT Version :9

Sequence 1:NP_001357232.1 Gene:RNF167 / 26001 HGNCID:24544 Length:374 Species:Homo sapiens
Sequence 2:XP_031755442.1 Gene:rnf167 / 100379947 XenbaseID:XB-GENE-5944055 Length:346 Species:Xenopus tropicalis


Alignment Length:339 Identity:177/339 - (52%)
Similarity:221/339 - (65%) Gaps:41/339 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    19 AAPT-RGLIRATSD---HNASMDFADLPALFGATLSQEGLQGFLVEAHPDNACSPIAPPPPAPVN 79
            |.|| ..:|.|.||   ....| |.|||||||.:|..:|::|.||:|.|:|||:||.|||..  |
 Frog    22 ALPTAHSMIYAYSDVRTREPQM-FDDLPALFGPSLPTDGMKGSLVQAVPENACTPILPPPTD--N 83

Human    80 GSVFIALLRRFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERS 144
            |:.||.|:||.|||||.|||:||.|||.||:||||.::.||.|.||.|.|::||.|||||.||.|
 Frog    84 GTSFIVLIRRNDCNFDTKVLHAQLAGYNAAIVHNVGADLLLRMGWNDESIRRQIRIPSVFTGESS 148

Human   145 SEYLRALFVYEKGARVLLVPDNTFPLGYYLIPFTGIVGLLVLAMGAVMIARCIQHRKRLQRNRLT 209
            ...|.|.|.|...:.:.||||..|.||||||||..:|.::::.|..||:.||.|:|||::||||:
 Frog   149 GRSLLANFSYYNNSHIYLVPDYYFSLGYYLIPFIVVVSVVIVVMCIVMVVRCAQYRKRMRRNRLS 213

Human   210 KEQLKQIPTHDYQKALNSSMFCPDLILPTCLISSTGFVGDQYDVCAICLDEYEDGDKLRVLPCAH 274
            |||||:||.|.::|                        ||.||||||||:|||:|||||||||:|
 Frog   214 KEQLKKIPIHKFKK------------------------GDDYDVCAICLEEYEEGDKLRVLPCSH 254

Human   275 AYHSRCVDPWLTQTRKTCPICKQPVHRGPGDEDQEEETQGQ-EEGDEGEPRDHPASERTPLLGSS 338
            |||..|||||||:|:|:||:||..|.|  .|.|.:.:|.|. ...|:||..|   :||||||..|
 Frog   255 AYHCSCVDPWLTKTKKSCPVCKNRVFR--SDSDSDSDTGGPVANDDQGEESD---NERTPLLRPS 314

Human   339 PTLPTSFGSLAPAP 352
            |    ||||:|.:|
 Frog   315 P----SFGSMAESP 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF167NP_001357232.1 PA_C_RZF_like 20..170 CDD:239038 82/153 (54%)
RING-H2_RNF167 252..297 CDD:319711 35/44 (80%)
RING-H2 finger (C3H2C3-type) 254..295 CDD:319711 32/40 (80%)
rnf167XP_031755442.1 PA_C_RZF_like 17..174 CDD:239038 83/154 (54%)
RING_Ubox 232..277 CDD:418438 35/44 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 110 1.000 Domainoid score I28007
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41046
Inparanoid 00.000 Not matched by this tool.
NCBI 1 1.000 - -
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 1 1.000 - - FOG0001489
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X670
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.