DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TSKU and CG4781

DIOPT Version :9

Sequence 1:NP_001305406.1 Gene:TSKU / 25987 HGNCID:28850 Length:367 Species:Homo sapiens
Sequence 2:NP_611951.1 Gene:CG4781 / 37943 FlyBaseID:FBgn0035043 Length:469 Species:Drosophila melanogaster


Alignment Length:425 Identity:94/425 - (22%)
Similarity:149/425 - (35%) Gaps:147/425 - (34%)


- Green bases have known domain annotations that are detailed below.


Human    15 MPWPLLL--LLA--------VSGAQTTRPCFP--------GCQCEVETFGLFDSFSLTRVDCSGL 61
            :.:.|||  |||        :...:|.|.|:|        .|:|...:...:.:.:| |:|||..
  Fly    10 LTFALLLTQLLAAHVARAEVIDAEETDRFCYPESSKNSRRSCECSNVSASPWGNRAL-RIDCSYK 73

Human    62 GPHI--MPVPIPLDTAHLDLSSNRLEMVNESVLAGPGYT--TLAGLDLSHNLLTSISPTAFSRLR 122
            ...:  :.:.:||....||||.|.|:.|       |.:|  :|..|:|.||.::.:....|.:|.
  Fly    74 DYKVADLSLLLPLYIDSLDLSWNALDSV-------PIFTSDSLHQLNLRHNNISQLVSGNFKQLT 131

Human   123 YLESLDLSHNGLTALPAESFTSSPLSDVNLSHNQLREVSVSAFTTHSQGRALHVDLSHNLIHRLV 187
            .|..|.|..|.:..|.:.||...|       |.|:                  :||:||.:|.|.
  Fly   132 SLRELYLGWNSIGKLESGSFDGLP-------HLQV------------------LDLAHNNLHLLP 171

Human   188 PHPTRAGLPAP--TIQSLNLAWNR-------------------------------LHAVPN--LR 217
            .|     |.||  .:.:|:::|||                               ||...|  |:
  Fly   172 GH-----LFAPLLVLGTLDISWNRRFNESGGDLYTGLGVNWKLSTLRLDACSLNDLHLPVNAPLK 231

Human   218 DLPLR----------------YLSLDGNPLAVIGPGAFAGLGGLTHLSLASLQRLPELAPSGFRE 266
            :|.||                .|.:..|.|..:.|...|.|..:..|.:..:..|..:..:....
  Fly   232 ELSLRRNQLKRIPTQLPETLLRLDISDNLLEELLPEDTANLTQVRQLFIEDMPVLQRVVANSLTH 296

Human   267 LPGLQVLDLSGNPKLNWAGAEVFSGL-------------------------------SSLQELDL 300
            :..|:.|....:.:|:...||.|..:                               :.|.||||
  Fly   297 VDVLETLSFQNSRQLSHLDAEAFGPIMTTPTKKRALRSLSFRGTMLRTFNSTLAPIFTQLAELDL 361

Human   301 SGTNLVPLPEALLLHLPALQSVSVGQDVRCRRLVR 335
            :|     ||......|..|:.:.|..:.||.:..|
  Fly   362 NG-----LPLQCDCELVWLKQLPVQTNGRCYKPAR 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TSKUNP_001305406.1 LRR_RI 52..305 CDD:238064 74/338 (22%)
leucine-rich repeat 76..99 CDD:275380 9/24 (38%)
leucine-rich repeat 100..123 CDD:275380 7/22 (32%)
LRR_8 103..157 CDD:290566 15/53 (28%)
leucine-rich repeat 124..145 CDD:275380 7/20 (35%)
leucine-rich repeat 147..170 CDD:275380 2/22 (9%)
leucine-rich repeat 171..197 CDD:275380 8/25 (32%)
leucine-rich repeat 200..219 CDD:275380 8/51 (16%)
LRR_8 221..279 CDD:290566 12/73 (16%)
leucine-rich repeat 221..244 CDD:275380 8/38 (21%)
leucine-rich repeat 245..269 CDD:275380 2/23 (9%)
LRR_8 268..321 CDD:290566 16/83 (19%)
leucine-rich repeat 270..294 CDD:275380 6/54 (11%)
leucine-rich repeat 295..316 CDD:275380 8/20 (40%)
CG4781NP_611951.1 leucine-rich repeat 90..108 CDD:275380 9/24 (38%)
LRR_8 108..167 CDD:290566 21/83 (25%)
leucine-rich repeat 109..132 CDD:275380 7/22 (32%)
LRR_RI <121..>261 CDD:238064 35/169 (21%)
leucine-rich repeat 133..156 CDD:275380 8/29 (28%)
leucine-rich repeat 157..180 CDD:275380 11/45 (24%)
leucine-rich repeat 181..208 CDD:275380 4/26 (15%)
leucine-rich repeat 230..253 CDD:275380 4/22 (18%)
leucine-rich repeat 254..274 CDD:275380 6/19 (32%)
leucine-rich repeat 275..299 CDD:275380 2/23 (9%)
leucine-rich repeat 300..319 CDD:275380 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45617
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.