DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KRT23 and LamC

DIOPT Version :9

Sequence 1:NP_056330.3 Gene:KRT23 / 25984 HGNCID:6438 Length:422 Species:Homo sapiens
Sequence 2:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster


Alignment Length:406 Identity:102/406 - (25%)
Similarity:176/406 - (43%) Gaps:71/406 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    42 RISLSFTTRSCPPPGGSWGS--GRSSP-----LLGGNGKATMQNLNDRLASYLEKVRALEEANMK 99
            |:|.:.|  |.|..|.|..|  |.:||     ......|..:|:||||||.|::::|.||..|.:
  Fly    11 RVSRAST--STPVGGASTSSRVGATSPTSPTRTSRQQEKEELQHLNDRLACYIDRMRNLENENSR 73

Human   100 L-------------ESRILKWHQQRD--------PGSKKDYSQYEENITHLQEQ------IVDGK 137
            |             |:..||...:::        ..:.|:.::.|.:|..|.|:      .:|.|
  Fly    74 LTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKK 138

Human   138 MTNAQIILLIDNARMAVDDFN-------------LKYENEHSFKKDLEIEVEGLRRTLDNL---- 185
            ...|.:  ..:|||:..:.:|             .|:|::   .|:|.:|.|.|||.||:|    
  Fly   139 TKEATV--AENNARLYENRYNEVNGKYNQSLADRKKFEDQ---AKELALENERLRRQLDDLRKQL 198

Human   186 ---TIVTTDLEQEVEGMRKELILMKKHHEQEMEKHHVPSDFNVNV---KVDTGPREDLIKVLEDM 244
               |:...|||.:.:.:|:||....:.|.||:.:........::.   ::.......|.:.|:::
  Fly   199 EAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIEISEIDGRLSRQYEAKLQQSLQEL 263

Human   245 RQEYELIIKKKHRDLDTWYKEQ----SAAMSQEAASPATVQSRQGDIHELKRTFQALEIDLQTQY 305
            |.:||..::....:::..|..:    .||.::.|...|....   ::..::.....|...||...
  Fly   264 RDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALATE---EVRLMRTKIDGLNAKLQNLE 325

Human   306 STKSALENMLSETQSRYSCKLQDMQEIISHYEEELTQLRHELERQNNEYQVLLGIKTHLEKEITT 370
            .|.:.|...:.|.::....:.|...:.|:..|.||.::|.|:..|..|||.|:.||..|:.||..
  Fly   326 DTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAA 390

Human   371 YRRLLEGESEGTREES 386
            |.:||.||......||
  Fly   391 YDKLLCGEERRLNIES 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KRT23NP_056330.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..73 11/37 (30%)
Head 1..71 11/35 (31%)
Filament 71..380 CDD:278467 89/362 (25%)
Coil 1A 72..107 16/47 (34%)
Linker 1 108..125 2/24 (8%)
Coil 1B 126..217 32/116 (28%)
Linker 12 218..240 1/24 (4%)
Coil 2 241..378 35/140 (25%)
Rod-like helical tail 379..422 2/8 (25%)
LamCNP_001260974.1 Filament 45..401 CDD:278467 89/363 (25%)
ATP-synt_B <67..>142 CDD:304375 14/74 (19%)
MreC <178..>224 CDD:302802 17/45 (38%)
LTD 473..574 CDD:279300
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.