DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drr-2 and eIF4B

DIOPT Version :9

Sequence 1:NP_499818.1 Gene:drr-2 / 259546 WormBaseID:WBGene00011730 Length:207 Species:Caenorhabditis elegans
Sequence 2:NP_001015319.1 Gene:eIF4B / 3355041 FlyBaseID:FBgn0020660 Length:459 Species:Drosophila melanogaster


Alignment Length:241 Identity:61/241 - (25%)
Similarity:88/241 - (36%) Gaps:70/241 - (29%)


- Green bases have known domain annotations that are detailed below.


 Worm     6 FKAFIGGLPYDSIATDIETILKHCKFTDEELKKFDIHLVHDRDSGSFKGFAYVTFENEQQMNTAI 70
            |.|:|..||:|:...|:....:........|.:      .|.::|..:||.||..||.:.:...:
  Fly    80 FIAYINNLPFDANEDDLYEFFEGINLISLRLPR------EDGENGRSRGFGYVELENREDLIHVL 138

 Worm    71 S----GLNGADFGNRVLKVNRAQQRDRSDRGGGRGGRGGNFGDRGGRGRGAGGFRRGGEGGRFNE 131
            |    .:.|......:...|..|.|.:|:|      |...||:.|. .|.:|.:||..:    |.
  Fly   139 SLPDPSIKGRRIRIELSNENDQQSRQKSNR------RFDGFGNNGD-NRDSGNWRRDSQ----NN 192

 Worm   132 GERRG---GFGGGGHR--------------GGYR------------QRRESE------------- 154
            |...|   .|....:|              |.:|            .|||.|             
  Fly   193 GSNFGYSSNFERSFNRERKSLPDRDDVNTPGSWRTSARPQSIDTSPTRREVEQVSEKYREGRVKI 257

 Worm   155 -EQHKAEETSDPSAPPAERPRLNLKPRT---TDAAEIEARKKQEEE 196
             :::..||||...   .|||:|||||||   .|...||..|...:|
  Fly   258 ADRYSREETSKVE---EERPKLNLKPRTLPLPDVKTIEFEKCDVDE 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drr-2NP_499818.1 RRM_SF 6..88 CDD:388407 19/85 (22%)
eIF4BNP_001015319.1 RRM <72..268 CDD:223796 45/204 (22%)
RRM_eIF4B 79..155 CDD:240848 18/80 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1530583at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1292
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.040

Return to query results.
Submit another query.