Sequence 1: | NP_499818.1 | Gene: | drr-2 / 259546 | WormBaseID: | WBGene00011730 | Length: | 207 | Species: | Caenorhabditis elegans |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001015319.1 | Gene: | eIF4B / 3355041 | FlyBaseID: | FBgn0020660 | Length: | 459 | Species: | Drosophila melanogaster |
Alignment Length: | 241 | Identity: | 61/241 - (25%) |
---|---|---|---|
Similarity: | 88/241 - (36%) | Gaps: | 70/241 - (29%) |
- Green bases have known domain annotations that are detailed below.
Worm 6 FKAFIGGLPYDSIATDIETILKHCKFTDEELKKFDIHLVHDRDSGSFKGFAYVTFENEQQMNTAI 70
Worm 71 S----GLNGADFGNRVLKVNRAQQRDRSDRGGGRGGRGGNFGDRGGRGRGAGGFRRGGEGGRFNE 131
Worm 132 GERRG---GFGGGGHR--------------GGYR------------QRRESE------------- 154
Worm 155 -EQHKAEETSDPSAPPAERPRLNLKPRT---TDAAEIEARKKQEEE 196 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
drr-2 | NP_499818.1 | RRM_SF | 6..88 | CDD:388407 | 19/85 (22%) |
eIF4B | NP_001015319.1 | RRM | <72..268 | CDD:223796 | 45/204 (22%) |
RRM_eIF4B | 79..155 | CDD:240848 | 18/80 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1530583at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1292 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.040 |