DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NECTIN3 and igcm-1

DIOPT Version :10

Sequence 1:XP_011510965.1 Gene:NECTIN3 / 25945 HGNCID:17664 Length:580 Species:Homo sapiens
Sequence 2:NP_508166.1 Gene:igcm-1 / 180433 WormBaseID:WBGene00018215 Length:1073 Species:Caenorhabditis elegans


Alignment Length:373 Identity:82/373 - (21%)
Similarity:144/373 - (38%) Gaps:112/373 - (30%)


- Green bases have known domain annotations that are detailed below.


Human    94 EPHVTAVWGKNVSLKCLIE---VNETITQISWEKIHG-------KSSQTVAVHHPQY---GFSVQ 145
            ||:......:.:.:.|:::   .:....:|:|.:.:.       |:.:.:|..|.::   ..|..
 Worm    34 EPYFLQEGNEGIVIPCVVKPEYFDRQKYEINWARYNNGQLRMITKNDKLLAKKHSRFILENDSAT 98

Human   146 GEYQGRVLFKNYSLNDATITLHNIGFSDSGKYICKAVTFPLGNAQSS--TTVTVLVEPTVSLIK- 207
            |         ||||....:..:::    .|.|.|..:.....:.|.|  .||.|||.|...:|. 
 Worm    99 G---------NYSLRITEVEKNSV----EGTYHCNVIGTDDSDVQYSALATVVVLVPPGDPIIST 150

Human   208 -GPDSLIDGGNETVAAICIAATGKPVAHIDWEGDLGEMESTTTSFPNETATIISQYKLFPTRFA- 270
             ..:|:|:|  :.:.|.|::..|.|.....|            :.||:|   |:...:|.|:|. 
 Worm   151 TPSESVIEG--DFMTAKCVSVGGSPQPTFTW------------TLPNDT---IASSAIFTTQFRD 198

Human   271 ---------------RGRRITCVVKHPAL----EKDIRYSFILDIQYAPEVSVTGYDGNWFVG-R 315
                           .|:.:.|.|.:.|:    .|.:: |..|::.|.|.|.||..:....:. .
 Worm   199 GATESLLHFRVTSSDDGKSVQCDVTNRAMLGGETKQVK-SSQLNVLYKPVVFVTPTENLTHLSVE 262

Human   316 KG--VNLKCNADANPPPFKSVW------SRLDGQ-WPDGLLASDNTLHFVHPLTFNYSGVYICKV 371
            :|  |||.||:.:|||.....|      .|..|: ||   :..|:::          ||.:.|:.
 Worm   263 EGELVNLTCNSASNPPAHSYEWKHIASGERYQGKIWP---IRVDSSM----------SGDFECRS 314

Human   372 TNSLGQRSDQKVIYISDPPTTTTLQPTIQWHP--------STADIEDL 411
            ||.||:             .|..|:..:|..|        |..::||:
 Worm   315 TNELGE-------------GTAVLKMVVQHIPRINVPESISPNEMEDI 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NECTIN3XP_011510965.1 IgV_1_Nectin-3_like 89..198 CDD:409470 21/118 (18%)
FR1 89..112 CDD:409470 3/17 (18%)
Ig strand A 89..93 CDD:409470
Ig strand A' 95..99 CDD:409470 1/3 (33%)
Ig strand B 104..112 CDD:409470 1/7 (14%)
CDR1 113..117 CDD:409470 0/3 (0%)
FR2 118..124 CDD:409470 2/5 (40%)
Ig strand C 119..124 CDD:409470 2/4 (50%)
CDR2 125..144 CDD:409470 3/28 (11%)
Ig strand C' 134..139 CDD:409470 2/4 (50%)
Ig strand C' 141..145 CDD:409470 1/3 (33%)
FR3 145..183 CDD:409470 8/37 (22%)
Ig strand D 152..156 CDD:409470 0/3 (0%)
Ig strand E 161..168 CDD:409470 0/6 (0%)
Ig strand F 175..183 CDD:409470 3/7 (43%)
CDR3 184..187 CDD:409470 0/2 (0%)
Ig strand G 187..197 CDD:409470 4/11 (36%)
FR4 188..198 CDD:409470 4/11 (36%)
IgC1_2_Nectin-3-4_like 201..296 CDD:409501 24/116 (21%)
Ig strand A 201..207 CDD:409501 1/5 (20%)
Ig strand B 220..227 CDD:409501 2/6 (33%)
Ig strand C 232..238 CDD:409501 0/5 (0%)
Ig strand C' 240..242 CDD:409501 0/1 (0%)
Ig strand D 244..251 CDD:409501 0/6 (0%)
Ig strand E 256..264 CDD:409501 1/7 (14%)
Ig strand F 274..281 CDD:409501 2/6 (33%)
Ig strand G 287..293 CDD:409501 1/5 (20%)
Ig 300..386 CDD:472250 26/95 (27%)
Ig strand B 318..322 CDD:409353 3/3 (100%)
Ig strand C 332..336 CDD:409353 1/9 (11%)
Ig strand E 351..356 CDD:409353 0/4 (0%)
Ig strand F 366..371 CDD:409353 1/4 (25%)
Ig strand G 381..384 CDD:409353 0/2 (0%)
TM_EGFR-like 435..463 CDD:213052
igcm-1NP_508166.1 Ig 140..235 CDD:472250 24/111 (22%)
Ig strand B 162..166 CDD:409418 1/3 (33%)
Ig strand C 176..181 CDD:409418 1/16 (6%)
Ig strand E 203..207 CDD:409418 0/3 (0%)
Ig strand F 217..222 CDD:409418 1/4 (25%)
Ig strand G 231..234 CDD:409418 0/2 (0%)
Ig_3 245..316 CDD:464046 22/83 (27%)
Ig_3 333..398 CDD:464046 4/17 (24%)
IG_like 437..513 CDD:214653
Ig strand B 443..447 CDD:409353
Ig strand C 458..461 CDD:409353
Ig strand E 478..482 CDD:409353
Ig strand F 492..497 CDD:409353
Ig 538..617 CDD:409353
Ig strand C 549..553 CDD:409353
Ig strand E 586..590 CDD:409353
Ig strand F 601..606 CDD:409353
Ig 642..727 CDD:472250
Ig strand B 650..654 CDD:409353
Ig strand C 663..667 CDD:409353
Ig strand E 688..699 CDD:409353
Ig strand F 709..714 CDD:409353
FN3 733..843 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.