DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NECTIN3 and nectin3

DIOPT Version :10

Sequence 1:XP_011510965.1 Gene:NECTIN3 / 25945 HGNCID:17664 Length:580 Species:Homo sapiens
Sequence 2:XP_002940155.1 Gene:nectin3 / 100496233 XenbaseID:XB-GENE-963226 Length:524 Species:Xenopus tropicalis


Alignment Length:548 Identity:324/548 - (59%)
Similarity:394/548 - (71%) Gaps:37/548 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    38 PLLLLLFPLLLFSRLCVWHPGDCFSCKTIDCPPFILLNKLSREDLLHCALAGPIIVEPHVTAVWG 102
            |.|.....|||..|||                               .:.|||:.|:||||||||
 Frog     9 PSLSAALALLLLCRLC-------------------------------GSFAGPVHVDPHVTAVWG 42

Human   103 KNVSLKCLIEVNETITQISWEKIHGKSSQTVAVHHPQYGFSVQGEYQGRVLFKNYSLNDATITLH 167
            ||::|||||||||||||||||:|.||.:||:|||||.||.|....||.|..|||.||:||||.:.
 Frog    43 KNITLKCLIEVNETITQISWERIIGKGAQTIAVHHPIYGTSFDESYQQRTTFKNTSLHDATIVIS 107

Human   168 NIGFSDSGKYICKAVTFPLGNAQSSTTVTVLVEPTVSLIKGPDSLIDGGNETVAAICIAATGKPV 232
            ||.|||:|:||||||||||||.|||||:|||||||||::|||:.|:||.||||||.|.||||||.
 Frog   108 NIEFSDAGEYICKAVTFPLGNVQSSTTLTVLVEPTVSILKGPEPLLDGANETVAAYCSAATGKPA 172

Human   233 AHIDWEGDLGEMESTTTSFPNETATIISQYKLFPTRFARGRRITCVVKHPALEKDIRYSFILDIQ 297
            |.:.|||.||.||:..||:||:|.|::|||:|.|:||||||.|||||||||||.||||.|.||||
 Frog   173 AEVSWEGSLGRMETNVTSYPNKTVTVMSQYRLVPSRFARGRNITCVVKHPALENDIRYPFTLDIQ 237

Human   298 YAPEVSVTGYDGNWFVGRKGVNLKCNADANPPPFKSVWSRLDGQWPDGLLASDNTLHFVHPLTFN 362
            ||||||:||||.||||||..|.||||:||||.|.:..|:||||.||:||.:.:|||.|..|||.|
 Frog   238 YAPEVSITGYDDNWFVGRTDVYLKCNSDANPSPTEIKWTRLDGIWPEGLQSVNNTLLFSLPLTHN 302

Human   363 YSGVYICKVTNSLGQRSDQKVIYISDPPTTTTLQPTIQWHPSTADIEDLATEPKKLPFPLSTLAT 427
            .||:|.|||.|:|||:||||:|.|.|||.||. .|||....||.||..:.|..||:..|.|||||
 Frog   303 VSGIYECKVANALGQKSDQKIITILDPPATTP-PPTIPQTHSTTDIVGIETSSKKIHIPASTLAT 366

Human   428 IKDDTIATIIASVVGGALFIVLVSVLAGIFCYRRRRTFRGDYFAKNYIPPSDMQKESQIDVLQQD 492
            ::|....||:.|||||.||::|:.|:.||..|||::|||||||.|:|||||||||||||||||.:
 Frog   367 LQDGNFGTIVGSVVGGCLFLILLIVIFGIIYYRRKQTFRGDYFTKSYIPPSDMQKESQIDVLQPE 431

Human   493 ELDSYPDSVKKENKNPVNNLIRKDYLEEPEKTQWNNVENLNR----FERPMDYYEDLKMGMKFVS 553
            :||.:|::.||:.....|:.|..:||::.|.:.||||...:|    |:|||..|.|.:|.:....
 Frog   432 DLDPFPENPKKDINIKANDHIYNEYLQDVENSGWNNVITYDRYQEHFDRPMTNYPDKQMPVVSRY 496

Human   554 DEH-YDENEDDLVSHVDGSVISRREWYV 580
            ::: :::||||||||||||:||||||||
 Frog   497 NKNCFNDNEDDLVSHVDGSLISRREWYV 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NECTIN3XP_011510965.1 IgV_1_Nectin-3_like 89..198 CDD:409470 79/108 (73%)
FR1 89..112 CDD:409470 17/22 (77%)
Ig strand A 89..93 CDD:409470 2/3 (67%)
Ig strand A' 95..99 CDD:409470 3/3 (100%)
Ig strand B 104..112 CDD:409470 5/7 (71%)
CDR1 113..117 CDD:409470 3/3 (100%)
FR2 118..124 CDD:409470 5/5 (100%)
Ig strand C 119..124 CDD:409470 4/4 (100%)
CDR2 125..144 CDD:409470 12/18 (67%)
Ig strand C' 134..139 CDD:409470 4/4 (100%)
Ig strand C' 141..145 CDD:409470 2/3 (67%)
FR3 145..183 CDD:409470 23/37 (62%)
Ig strand D 152..156 CDD:409470 1/3 (33%)
Ig strand E 161..168 CDD:409470 4/6 (67%)
Ig strand F 175..183 CDD:409470 6/7 (86%)
CDR3 184..187 CDD:409470 2/2 (100%)
Ig strand G 187..197 CDD:409470 7/9 (78%)
FR4 188..198 CDD:409470 7/9 (78%)
IgC1_2_Nectin-3-4_like 201..296 CDD:409501 65/94 (69%)
Ig strand A 201..207 CDD:409501 4/5 (80%)
Ig strand B 220..227 CDD:409501 4/6 (67%)
Ig strand C 232..238 CDD:409501 1/5 (20%)
Ig strand C' 240..242 CDD:409501 0/1 (0%)
Ig strand D 244..251 CDD:409501 3/6 (50%)
Ig strand E 256..264 CDD:409501 4/7 (57%)
Ig strand F 274..281 CDD:409501 5/6 (83%)
Ig strand G 287..293 CDD:409501 4/5 (80%)
Ig 300..386 CDD:472250 56/85 (66%)
Ig strand B 318..322 CDD:409353 2/3 (67%)
Ig strand C 332..336 CDD:409353 0/3 (0%)
Ig strand E 351..356 CDD:409353 3/4 (75%)
Ig strand F 366..371 CDD:409353 2/4 (50%)
Ig strand G 381..384 CDD:409353 2/2 (100%)
TM_EGFR-like 435..463 CDD:213052 16/27 (59%)
nectin3XP_002940155.1 Ig 29..138 CDD:472250 79/108 (73%)
Ig strand B 45..49 CDD:409353 1/3 (33%)
Ig strand C 59..63 CDD:409353 3/3 (100%)
Ig strand E 102..106 CDD:409353 3/3 (100%)
Ig strand F 116..121 CDD:409353 3/4 (75%)
Ig strand G 130..133 CDD:409353 2/2 (100%)
IgC1_2_Nectin-3-4_like 141..236 CDD:409501 65/94 (69%)
Ig strand A 141..147 CDD:409501 4/5 (80%)
Ig strand B 160..167 CDD:409501 4/6 (67%)
Ig strand C 172..178 CDD:409501 1/5 (20%)
Ig strand C' 180..182 CDD:409501 0/1 (0%)
Ig strand D 184..191 CDD:409501 3/6 (50%)
Ig strand E 196..204 CDD:409501 4/7 (57%)
Ig strand F 214..221 CDD:409501 5/6 (83%)
Ig strand G 227..233 CDD:409501 4/5 (80%)
Ig 240..326 CDD:472250 56/85 (66%)
Ig strand B 258..262 CDD:409353 2/3 (67%)
Ig strand C 272..276 CDD:409353 0/3 (0%)
Ig strand E 292..296 CDD:409353 2/3 (67%)
Ig strand F 306..311 CDD:409353 2/4 (50%)
Ig strand G 321..324 CDD:409353 2/2 (100%)
ECM27 347..>408 CDD:440296 31/60 (52%)

Return to query results.
Submit another query.