DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC5 and CG17197

DIOPT Version :9

Sequence 1:NP_056272.2 Gene:ZDHHC5 / 25921 HGNCID:18472 Length:715 Species:Homo sapiens
Sequence 2:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster


Alignment Length:312 Identity:72/312 - (23%)
Similarity:115/312 - (36%) Gaps:78/312 - (25%)


- Green bases have known domain annotations that are detailed below.


Human     8 RFKPSKYVPVS-AAAIFLVGATTLFFAFTCPGLSLYVSPAVPIYNAIMFLFVLANFSMATFMDPG 71
            |..|..:|.:| ..|:..|..||:||...   ...||.|  .:::...|::.| .:.:|.|:...
  Fly    13 RRNPKIFVRISHPTAVLFVIVTTIFFVVL---QMFYVVP--QLFDVQGFMYKL-GWLVAIFITYN 71

Human    72 IF----------------PRAEEDEDKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHC 120
            ||                |:..:..:.|::.               :..:|..|....|||..||
  Fly    72 IFGNMLACHITSTSVESLPKDRQIPEPEEEH---------------QWHYCDVCEKLMPPRSWHC 121

Human   121 SVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLL--------SLTAHIMGVFGF----GLLYVLY 173
            .:|..|:.:.|.||.:..:|:|..|.||||.|.|        :|..||:....:    .|:::..
  Fly   122 ILCKCCILKRDRHCIFTASCVGHNNQRYFFWFTLFMALGTGVALATHIIATLKYFSYSDLIFLNI 186

Human   174 HIEELSGVRTAVTMAVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVNPFTNGCCN 238
            ..:.|......:|:.:...  :|..||:.      ||:......|.....||..  :.:..|...
  Fly   187 PRDNLPPFWLVITLILNTY--VFAAPVSS------VLMQLSVLKNNGTLHKFYS--DTYDLGLWE 241

Human   239 NVSRVL------------CSSPAPRYLGRPKKEKTIVIRPP---FLRPEVSD 275
            |...:|            ..||.| :.|...|.|.:....|   |||  |||
  Fly   242 NFKLILGGKGFWTFLSPTVKSPLP-HDGAQWKIKRVQHHSPKLQFLR--VSD 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC5NP_056272.2 DHHC 99..224 CDD:366691 33/136 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..715
DUF4671 594..>704 CDD:374041
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 17/62 (27%)
zf-DHHC 100..>198 CDD:279823 26/112 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.