DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IFFO1 and LamC

DIOPT Version :9

Sequence 1:XP_011519249.1 Gene:IFFO1 / 25900 HGNCID:24970 Length:651 Species:Homo sapiens
Sequence 2:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster


Alignment Length:465 Identity:85/465 - (18%)
Similarity:162/465 - (34%) Gaps:173/465 - (37%)


- Green bases have known domain annotations that are detailed below.


Human   232 DTI---TPEIRALY-NVLAKVKRERDE-----------YKRRWEEEYTVRIQL------------ 269
            ||:   |..::|:| ..||..::..||           .||.|||...::.:|            
  Fly    83 DTVNRETSNLKAVYEKELAAARKLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAEN 147

Human   270 -----QDRVNELQEEAQEADACQ-------EELALKVEQLKAEL-VVFKGLMSNNLSELDTKIQE 321
                 ::|.||:..:..::.|.:       :||||:.|:|:.:| .:.|.|.:..|:.:|.:.|.
  Fly   148 NARLYENRYNEVNGKYNQSLADRKKFEDQAKELALENERLRRQLDDLRKQLEAETLARVDLENQN 212

Human   322 KAMKVDMDICRRIDITAKLCDVAQQRNCEDMIQMFQKKLVPSMGGRKRERKAAVEEDTSLSESEG 386
            ::::.::....::. |.:|.:...:|..|                              :||.:|
  Fly   213 QSLREELAFKDQVH-TQELTETRSRRQIE------------------------------ISEIDG 246

Human   387 --PRQPDGDEEESTALSINEEMQRMLNQLREYDFEDDCDSLTWEETEETLLLWEDFSGYAMAAAE 449
              .||.:.            ::|:.|.:||     |..:.......||..||:::......|||.
  Fly   247 RLSRQYEA------------KLQQSLQELR-----DQYEGQMRINREEIELLYDNEIQNLKAAAN 294

Human   450 --AQGEVTSAPGLRALWLCLSSLKPTPPLLSLLCPPMWLSSSTCVSPLPLSFCFSFSSFFNQTSS 512
              |||...:...:|.:...:..|...                                       
  Fly   295 RAAQGSALATEEVRLMRTKIDGLNAK--------------------------------------- 320

Human   513 LSLSLTWPFGMRPIPSLLGWPPPLPFLLQQQEDS---LEKVIKDTESLFKTREKEYQETIDQIEL 574
                                       ||..||:   |...|::.|:|..|..:.:.:.|..:|.
  Fly   321 ---------------------------LQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEA 358

Human   575 ELATAKNDMNRHLHEYMEMCSMKRGLDVQMETCRRLITQSGDRKSPAFTAVPLSDPPPPPSEAED 639
            ||...:::|...|.||..:..:|..||:::....:|:  .|:.:     .:.:..|..|     .
  Fly   359 ELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLL--CGEER-----RLNIESPGRP-----T 411

Human   640 SDRDVSSDSS 649
            :|..:||:.|
  Fly   412 TDSGISSNGS 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IFFO1XP_011519249.1 Filament 230..>360 CDD:278467 35/167 (21%)
Filament <540..610 CDD:278467 20/72 (28%)
LamCNP_001260974.1 Filament 45..401 CDD:278467 79/438 (18%)
ATP-synt_B <67..>142 CDD:304375 15/58 (26%)
MreC <178..>224 CDD:302802 12/45 (27%)
LTD 473..574 CDD:279300
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.