DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF19A and ari-1

DIOPT Version :9

Sequence 1:NP_001267468.1 Gene:RNF19A / 25897 HGNCID:13432 Length:838 Species:Homo sapiens
Sequence 2:NP_001245736.1 Gene:ari-1 / 32796 FlyBaseID:FBgn0017418 Length:503 Species:Drosophila melanogaster


Alignment Length:213 Identity:64/213 - (30%)
Similarity:97/213 - (45%) Gaps:31/213 - (14%)


- Green bases have known domain annotations that are detailed below.


Human   131 ECPLCLLRHSKDRFPDIMT---CHHRSCVDCLRQYLRIEISESRV--NISCPE--CTERFNPHDI 188
            ||.:|..:..    ||.|.   |.||.|:.|..:||..:|....:  .|||..  |....:...:
  Fly   132 ECEICFSQLP----PDSMAGLECGHRFCMPCWHEYLSTKIVAEGLGQTISCAAHGCDILVDDVTV 192

Human   189 RLILSDDVLMEKYEEFMLRRWLVADPDCRWCPAPDCGYAV-IAFGCASCPKLTCGREGCGTEFCY 252
            ..:::|..:..||::.:...::..:...||||:.||.||| :.:  |...::.|   .||..||:
  Fly   193 ANLVTDARVRVKYQQLITNSFVECNQLLRWCPSVDCTYAVKVPY--AEPRRVHC---KCGHVFCF 252

Human   253 HCKQIWHPNQTCDAARQERAQSLRLRTIRSSSISYSQESGAAADDIKPCPRCAAYIIKMNDGSCN 317
            .|.:.||....|...:         :.|:... ..|:.|...|.:.|.||||:..|.|  ||.||
  Fly   253 ACGENWHDPVKCRWLK---------KWIKKCD-DDSETSNWIAANTKECPRCSVTIEK--DGGCN 305

Human   318 HMTCAVCGC--EFCWLCM 333
            ||.|....|  ||||:|:
  Fly   306 HMVCKNQNCKNEFCWVCL 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF19ANP_001267468.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..61
TRIAD supradomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU01221 128..351 64/213 (30%)
RING-HC_RBR_RNF19A 131..185 CDD:319689 18/60 (30%)
RING-HC finger (C3HC4-type) 132..179 CDD:319689 16/53 (30%)
IBR 199..264 CDD:214763 20/65 (31%)
IBR <297..335 CDD:307574 20/39 (51%)
AzlC <361..450 CDD:321048
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 622..685
Interaction with CASR. /evidence=ECO:0000269|PubMed:16513638 660..838
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 700..721
ari-1NP_001245736.1 IBR 204..264 CDD:214763 20/64 (31%)
IBR <286..326 CDD:279784 20/40 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.