DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAMR1 and Corin

DIOPT Version :9

Sequence 1:NP_056245.2 Gene:PAMR1 / 25891 HGNCID:24554 Length:737 Species:Homo sapiens
Sequence 2:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster


Alignment Length:560 Identity:125/560 - (22%)
Similarity:204/560 - (36%) Gaps:173/560 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   227 DGFHAIYEEITACSSSPCFH-----DG--TCVLDKAGSYKC-------------ACLAGYTGQRC 271
            |||.        |..:.|..     ||  .| :|:|...||             .|:.  |...|
  Fly   911 DGFQ--------CDQNRCLPQEYVCDGHLDC-MDQADEAKCERCGPDEIYCGDSQCIG--TKHIC 964

Human   272 ENLLEAGKSKIKASEDSLSVLEERNC---SDPGGPVNGYQKITGGPGLINGRHAKIGTVVSFFCN 333
            :.:::....:           :||||   |:..|.|        |.|::  ...:||        
  Fly   965 DGIIDCPYGQ-----------DERNCLRLSERNGDV--------GTGVL--EVYRIG-------- 1000

Human   334 NSYVLSGNEKRTCQQNGEWSGKQPICIK----------AC---------REPKISDLVRRRVLPM 379
                           ..:|   .|.|:|          .|         ....::.|..|.:|  
  Fly  1001 ---------------QRQW---MPACVKNWDRAVSPSAVCSILGYSAVNATSVLTQLTHRPLL-- 1045

Human   380 QVQSRETPLHQLYSAAFSKQKLQSAPTKKPA-LPFGDLPMGYQHLHTQLQYECISPFYRRLGSSR 443
            ...:..|.:.::|:...|....:.|..||.. .|..||        |...|||        |..:
  Fly  1046 ATVNVSTDIWKMYAKRKSTLMQEFANCKKTEDYPMADL--------TCSNYEC--------GRVK 1094

Human   444 RTCLRTGKWSGRAPSCIPICGKIENITAPKTQGLRWPWQAAIYRRTSGVHDGSLHKGAWFLVCSG 508
            |         ||......|.|..:  .:|.    .||:.|||.        |...|   ...|:|
  Fly  1095 R---------GRHKPSRRIIGGTQ--ASPG----NWPFLAAIL--------GGPEK---IFYCAG 1133

Human   509 ALVNERTVVVAAHCVTDLGKVTMIKTADLKVVLGKFYRDDDRDEKTIQSLQISAIILHPNYD-PI 572
            .|::::.|:.|:|||   |..::|...|..:.||...|:.  ...:.|.:::.|:|.||.|: .|
  Fly  1134 VLISDQWVLTASHCV---GNYSVIDLEDWTIQLGVTRRNS--FTYSGQKVKVKAVIPHPQYNMAI 1193

Human   573 LLDADIAILKLLDKARISTRVQPICLAASRDLSTSFQESH----ITVAGWNVLADVRSPGFKNDT 633
            ..|.|||:.:|..:......:.|:||.     ..|.:..|    .||.||....| :.|....:.
  Fly  1194 AHDNDIALFQLATRVAFHEHLLPVCLP-----PPSVRNLHPGTLCTVIGWGKRED-KDPKSTYEY 1252

Human   634 LRSGV-VSVVDSLLCEEQHEDHGIPVSVTDNMFCASWEPTAPSDICTAETGGIAAVSFPGRASPE 697
            :.:.| |.::....|:|..::    ::|::.|.||.:: ....|.|..::||.....:||..:  
  Fly  1253 IVNEVQVPIITRNQCDEWLDN----LTVSEGMVCAGFD-DGGKDACQGDSGGPLLCPYPGEKN-- 1310

Human   698 PRWHLMGLVSWSYDKTCSH-RLSTAFTKVLPFKDWIERNM 736
             ||.:.|:|||..  .|:| ||...:..|:.:..||:..:
  Fly  1311 -RWFVGGIVSWGI--MCAHPRLPGVYANVVQYVPWIQEQI 1347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAMR1NP_056245.2 CUB 128..234 CDD:238001 3/6 (50%)
EGF_CA 240..272 CDD:238011 10/51 (20%)
CCP 297..360 CDD:153056 10/65 (15%)
CCP <425..460 CDD:153056 8/34 (24%)
Tryp_SPc 478..735 CDD:238113 71/263 (27%)
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549
LDLa 911..942 CDD:238060 10/39 (26%)
LDLa 945..979 CDD:238060 5/46 (11%)
SR 980..>1034 CDD:214555 12/89 (13%)
SRCR 992..1086 CDD:278931 21/131 (16%)
Tryp_SPc 1103..1343 CDD:214473 72/277 (26%)
Tryp_SPc 1104..1346 CDD:238113 74/279 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.