DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BRMS1 and CG14220

DIOPT Version :9

Sequence 1:XP_024304193.1 Gene:BRMS1 / 25855 HGNCID:17262 Length:304 Species:Homo sapiens
Sequence 2:NP_001245759.1 Gene:CG14220 / 32954 FlyBaseID:FBgn0031036 Length:327 Species:Drosophila melanogaster


Alignment Length:284 Identity:64/284 - (22%)
Similarity:126/284 - (44%) Gaps:37/284 - (13%)


- Green bases have known domain annotations that are detailed below.


Human     9 DTEEMEAEGDSAAEMNGEEEESEEERSGSQTESEEESSEMDDEDYERRRSECVSEMLDLEKQFSE 73
            ||.:.|:.||..:|.:.::....|.||.|:..:...:|..::....                 ||
  Fly    12 DTYDDESIGDERSEEDTDDASETEFRSPSRYGAMNGTSNSNNMGTN-----------------SE 59

Human    74 LKEKLFRERLSQLRLRLEEVGAERAPEYTEPLGGLQRSLKIRIQVAGIYKGFCLDVIRNKYECEL 138
            |||::::.:|..|:.::||:|....|||.:.:..|...||.|.::..:||.:..:.:...|..|.
  Fly    60 LKEQMYQHKLFNLQKQMEELGQLVHPEYLKRVKKLDSQLKERRRMNEVYKEYMRECVERDYVLEK 124

Human   139 QGAKQHLESEKLLLYDTLQGELQERIQRLEEDRQSLDLSSEWWDDK--LHARGSSRSWDSLPPSK 201
            ..|::..:.:.:.|.|.|..:.::|.:::|.:|.|::|:::..:.|  :..:...|..:.||..:
  Fly   125 MAAQKEYDEKMMDLKDNLISDFEDRKRQIENERFSIELTNDSMEIKTTITRKLRRRPNEPLPVIE 189

Human   202 RKKAPLVSGPYIVYMLQEIDILEDWTAIKKDLDPAVHSQ---------GDPQSSWHCTQDSRLPP 257
            :::.| .:|..:||.|.:.:|..|...|::.....|..|         ...|.|.|...:    |
  Fly   190 KRRKP-ATGQLLVYQLDDKEIESDLKIIQRGRPNPVPQQNGSGSYGSGSQQQQSMHVLAE----P 249

Human   258 ADRRTHRPLRVCPARLL----WCC 277
            .........|:...:||    |.|
  Fly   250 TSNSGLVETRIEDNKLLYERRWFC 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BRMS1XP_024304193.1 Sds3 60..>178 CDD:312195 30/117 (26%)
CG14220NP_001245759.1 Sds3 58..>171 CDD:285764 30/112 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4466
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1456563at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.