DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment POU2F3 and pdm2

DIOPT Version :9

Sequence 1:NP_001231611.1 Gene:POU2F3 / 25833 HGNCID:19864 Length:438 Species:Homo sapiens
Sequence 2:NP_001285877.1 Gene:pdm2 / 34673 FlyBaseID:FBgn0004394 Length:893 Species:Drosophila melanogaster


Alignment Length:499 Identity:189/499 - (37%)
Similarity:236/499 - (47%) Gaps:136/499 - (27%)


- Green bases have known domain annotations that are detailed below.


Human     2 ESPRTAKGGRDIKMSGDVADSTDARSTLSQVEPGNDRNGLDFNRQIKTEDL-------------- 52
            |.|  |..||..:.:..|.    ...:.|...|...|:..|..:..:.|:|              
  Fly   429 EQP--APNGRHCRPANKVM----RHMSNSPTPPSPLRSLSDCGKSFEEEELELGENCEMPQNLSS 487

Human    53 ---SDSLQQTLSHRPCHLSQGPAMMSGNQMSGLNAS--PCQDMA------------SLHPLQQLV 100
               :..|...|.:....|:..|..::..|.....||  |.|.:|            .||...::|
  Fly   488 KRQARELDSELENEVLDLAPPPKRLAEEQEEEKVASVNPPQPVAFAPEEMHQALQLQLHSYIEMV 552

Human   101 -----------------LVPGHLQSVSQFLLSQTQPGQQGLQPNLLP---FPQQQSGLLLPQTGP 145
                             |:...||:::||...|....||...|  ||   .|..:|.|..|...|
  Fly   553 RQLAPEAFPNPNLATQFLLQNSLQALAQFQALQQMKQQQREDP--LPSYSTPLAKSPLRSPSLSP 615

Human   146 ---------------------GLASQAFGHPGLPGSSLEPHLEASQHLPVPKHLPSSG------- 182
                                 |::| |...|..|....:|.|:.|    .||  |:||       
  Fly   616 VPRHSKSQQRTPPNSMTANSLGMSS-AVMTPNTPSMQQQPQLQQS----TPK--PTSGLTVASAM 673

Human   183 -----GADEPSDLEELEKFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFK 242
                 ..:|.:||||||:|||||||||||||||||||||||||||||||||||||||||||||||
  Fly   674 AKLEQSPEETTDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFK 738

Human   243 NMCKLKPLLEKWLNDAESSPS---------DPSVSTPSSYPSLSEVFGRKRKKRTSIETNIRLTL 298
            |||||||||:|||.||:|:.:         :...||.||.|  ..:.||:|||||||||.:|.||
  Fly   739 NMCKLKPLLQKWLEDADSTVAKSGGGVFNINTMTSTLSSTP--ESILGRRRKKRTSIETTVRTTL 801

Human   299 EKRFQDNPKPSSEEISMIAEQLSMEKEVVRVWFCNRRQKEKRIN------CPVATPIKPPVYNSR 357
            ||.|..|.||:|||||.::|:|:|:|||:|||||||||||||||      .|..||:.       
  Fly   802 EKAFLMNCKPTSEEISQLSERLNMDKEVIRVWFCNRRQKEKRINPSLDLDSPTGTPLS------- 859

Human   358 LVSPSGSLG--PLSVPPVHSTMPGTVTSSCSPGNNSRPSSPGSG 399
                |.:.|  |.::...|..|.|...|.|.       ||..||
  Fly   860 ----SHAFGYPPQALNMSHMQMEGGSGSFCG-------SSISSG 892

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
POU2F3NP_001231611.1 POU 185..259 CDD:197673 67/73 (92%)
Homeobox 286..339 CDD:278475 37/52 (71%)
pdm2NP_001285877.1 POU 691..755 CDD:197673 60/63 (95%)
Homeobox 789..842 CDD:278475 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 142 1.000 Domainoid score I4687
eggNOG 1 0.900 - - E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003004
OrthoInspector 1 1.000 - - mtm8655
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11636
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.