DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BACE2 and cathD

DIOPT Version :9

Sequence 1:NP_036237.2 Gene:BACE2 / 25825 HGNCID:934 Length:518 Species:Homo sapiens
Sequence 2:NP_001334713.1 Gene:cathD / 45268 FlyBaseID:FBgn0029093 Length:392 Species:Drosophila melanogaster


Alignment Length:374 Identity:95/374 - (25%)
Similarity:150/374 - (40%) Gaps:93/374 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    92 YYLEMLIGTPPQKLQILVDTGSSNFAVAGTP-H-----SYIDTYFDTERSSTYRSKGFDVTVKYT 150
            ||..:.||:|||..:::.||||||..|.... |     ..:...:|..:|.||...|.:..::|.
  Fly    73 YYGPIAIGSPPQNFRVVFDTGSSNLWVPSKKCHLTNIACLMHNKYDASKSKTYTKNGTEFAIQYG 137

Human   151 QGSWTGFVGEDLVTIPKGFNTSFLVNIATIFESENFFLPGI-----KWNGILGLAYATLA----K 206
            .||.:|::..|.|:|..       ::|.....:|....||:     |::|||||.|.:::    |
  Fly   138 SGSLSGYLSTDTVSIAG-------LDIKDQTFAEALSEPGLVFVAAKFDGILGLGYNSISVDKVK 195

Human   207 PSSSLETFFDSLVTQANI-PNVFSMQMCGAGLPVAGSGTNGGSLVLGGIEPSLYKGDIWYTPIKE 270
            |.      |.::..|..| ..|||..     |....:...||.::.||.:|:.|.|:..|.|:..
  Fly   196 PP------FYAMYEQGLISAPVFSFY-----LNRDPASPEGGEIIFGGSDPNHYTGEFTYLPVTR 249

Human   271 EWYYQIEILKLEIGGQSLNLDCREYNADKAIVDSGTTLLRLP--------QKVFDAVV---EAVA 324
            :.|:||::....||...|   |:  ...:.|.|:||:|:..|        ||:....:   :.|.
  Fly   250 KAYWQIKMDAASIGDLQL---CK--GGCQVIADTGTSLIAAPLEEATSINQKIGGTPIIGGQYVV 309

Human   325 RASLIPEFSDGFWTGSQLACWTNSETPWSYFPKISIYLRDENSSRSFRITILPQLYIQPMMG--- 386
            ...|||:                       .|.|...|    ..::|.:.....:.....||   
  Fly   310 SCDLIPQ-----------------------LPVIKFVL----GGKTFELEGKDYILRVAQMGKTI 347

Human   387 -----AGLNYECYRFGISPSTNAL-VIGATVMEGFYVIFDRAQKRVGFA 429
                 .||:       |.|....| ::|...:..:|..||....|||||
  Fly   348 CLSGFMGLD-------IPPPNGPLWILGDVFIGKYYTEFDMGNDRVGFA 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BACE2NP_036237.2 beta_secretase_like 89..450 CDD:133140 95/374 (25%)
Asp 92..430 CDD:278455 95/374 (25%)
cathDNP_001334713.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.