DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BACE2 and Bace

DIOPT Version :9

Sequence 1:NP_036237.2 Gene:BACE2 / 25825 HGNCID:934 Length:518 Species:Homo sapiens
Sequence 2:NP_001285756.1 Gene:Bace / 34182 FlyBaseID:FBgn0032049 Length:372 Species:Drosophila melanogaster


Alignment Length:362 Identity:103/362 - (28%)
Similarity:155/362 - (42%) Gaps:65/362 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    82 DNLQGDSGRGYYLEMLIGTPPQKLQILVDTGSSNFAV--------AGTPHSYIDTYFDTERSSTY 138
            :.|.......||..:.||||.|..::|.|:||||..|        |...|:    .:|:..||||
  Fly    59 EQLSNSMNMAYYGAISIGTPAQSFKVLFDSGSSNLWVPSNTCKSDACLTHN----QYDSSASSTY 119

Human   139 RSKGFDVTVKYTQGSWTGFVGEDLVTIPKGFNTSFLVNIATIFESENFFLPGIKWN-----GILG 198
            .:.|...:::|..||.||::..|.|.:     ....:...|..||.|  .||..:|     ||||
  Fly   120 VANGESFSIQYGTGSLTGYLSTDTVDV-----NGLSIQSQTFAESTN--EPGTNFNDANFDGILG 177

Human   199 LAYATLAKPSSSLETFFDSLVTQANIPN-VFSMQMCGAGLPVAGSGTNGGSLVLGGIEPSLYKGD 262
            :||.:||  ...:...|.::|:|..:.| |||..     |...|:.|.||.|:.||.:.|||.|.
  Fly   178 MAYESLA--VDGVAPPFYNMVSQGLVDNSVFSFY-----LARDGTSTMGGELIFGGSDASLYSGA 235

Human   263 IWYTPIKEEWYYQIEILKLEIGGQSLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARAS 327
            :.|.||.|:.|:|..:....|.|.||..||      :||.|:||:|:..|...:      :..:.
  Fly   236 LTYVPISEQGYWQFTMAGSSIDGYSLCDDC------QAIADTGTSLIVAPYNAY------ITLSE 288

Human   328 LIPEFSDGFWTGSQLACWTNSETPWSYFPKISIYLRDENSSRSFRITILPQLYIQPMMGAGLNYE 392
            ::....||:...|.:          |..|.::..:...|      ..:.|..||....|     .
  Fly   289 ILNVGEDGYLDCSSV----------SSLPDVTFNIGGTN------FVLKPSAYIIQSDG-----N 332

Human   393 CYRFGISPSTNALVIGATVMEGFYVIFDRAQKRVGFA 429
            |........|:..::|...:..:|..||....|:|||
  Fly   333 CMSAFEYMGTDFWILGDVFIGQYYTEFDLGNNRIGFA 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BACE2NP_036237.2 beta_secretase_like 89..450 CDD:133140 102/355 (29%)
Asp 92..430 CDD:278455 102/352 (29%)
BaceNP_001285756.1 pepsin_retropepsin_like 59..369 CDD:299705 101/360 (28%)
Asp 68..371 CDD:278455 102/353 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151475
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.