DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB5 and CG5504

DIOPT Version :9

Sequence 1:NP_001128477.1 Gene:DNAJB5 / 25822 HGNCID:14887 Length:420 Species:Homo sapiens
Sequence 2:NP_995932.1 Gene:CG5504 / 48844 FlyBaseID:FBgn0002174 Length:520 Species:Drosophila melanogaster


Alignment Length:377 Identity:114/377 - (30%)
Similarity:163/377 - (43%) Gaps:79/377 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    72 VMGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKE-PNAEEKFKEIAEAYDVLSDPKKRGL 135
            ::.||||..||:...||..:|||||.::|.|||||.||| |:|..||:|::|||:||||.:||..
  Fly    61 LLAKDYYATLGVAKNANGKDIKKAYYQLAKKYHPDTNKEDPDAGRKFQEVSEAYEVLSDEQKRRE 125

Human   136 YDQYGE--EGL-KTGGGTSGGSSGSF-------HYTFHG--DPHATFASFFG----GSNPFDIFF 184
            ||.||:  |.: :.|||..||.:|.|       .:.|..  ||...|...||    .:|.|| .|
  Fly   126 YDTYGQTAENIGRQGGGFPGGGAGGFGPEGFSQSWQFRSSIDPEELFRKIFGEGNFRTNSFD-DF 189

Human   185 ASSRSTRPFSGFDPDD---MDVDEDEDPFGAFGRFGFNGLSRGPRRAPEPLYPRRK--------- 237
            |.|:     .||....   ||:...:...|.......|.:.:.|:.|.....|..|         
  Fly   190 ADSK-----FGFGQAQEMVMDLTFAQAARGVNKDVNVNVVDQCPKCAGTKCEPGTKPGRCQYCNG 249

Human   238 -----VQDPPVVHELRVSLEEIYHGSTKRMKITRRRLNPDGRTVRTEDKILHIVIKRGWKEGTKI 297
                 |...|.|..   |......|:.:.:|.........||||:..                |:
  Fly   250 TGFETVSTGPFVMR---STCRYCQGTRQHIKYPCSECEGKGRTVQRR----------------KV 295

Human   298 TFP-----KEGDATPDNIPADIVFV-LKDKPHAHFRRDGTNVLYSALISLKEALCGCTVNIPTI- 355
            |.|     :.|......:.:..:|| .:.:...:|||:|.:|...|.|||.:|:.|.||.:..: 
  Fly   296 TVPVPAGIENGQTVRMQVGSKELFVTFRVERSDYFRREGADVHTDAAISLAQAVLGGTVRVQGVY 360

Human   356 DGRVIPLPCNDVIKPGTVKR----LRGEGLPFPKVPTQ-RGDLIVEFKVRFP 402
            :.:.|.      ::|||...    |||:||  .:|... .||..|..|:..|
  Fly   361 EDQWIN------VEPGTSSHHKIMLRGKGL--KRVNAHGHGDHYVHVKITVP 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJB5NP_001128477.1 DnaJ 72..415 CDD:223560 114/377 (30%)
CG5504NP_995932.1 DnaJ 63..437 CDD:223560 114/375 (30%)
DnaJ 65..127 CDD:278647 35/61 (57%)
DnaJ_zf 227..287 CDD:199908 10/62 (16%)
DnaJ_C 288..409 CDD:199909 37/141 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.