DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB5 and jdp

DIOPT Version :10

Sequence 1:NP_001128477.1 Gene:DNAJB5 / 25822 HGNCID:14887 Length:420 Species:Homo sapiens
Sequence 2:NP_651807.1 Gene:jdp / 43630 FlyBaseID:FBgn0027654 Length:195 Species:Drosophila melanogaster


Alignment Length:71 Identity:27/71 - (38%)
Similarity:48/71 - (67%) Gaps:1/71 - (1%)


- Green bases have known domain annotations that are detailed below.


Human    75 KDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNK-EPNAEEKFKEIAEAYDVLSDPKKRGLYDQ 138
            :|:|.:|.....::.::|:..|:.:||:||||||. :..||.||:::.||.:.|.||:||.:||:
  Fly    16 EDFYGLLHCDENSSPEQIQAEYKVLALQYHPDKNSGDKEAEAKFQQLKEAKETLCDPEKRAIYDK 80

Human   139 YGEEGL 144
            :...|:
  Fly    81 WRNSGI 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJB5NP_001128477.1 DnaJ_bact 76..415 CDD:274090 27/70 (39%)
jdpNP_651807.1 DnaJ 17..79 CDD:395170 24/61 (39%)

Return to query results.
Submit another query.