DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB5 and CG3061

DIOPT Version :10

Sequence 1:NP_001128477.1 Gene:DNAJB5 / 25822 HGNCID:14887 Length:420 Species:Homo sapiens
Sequence 2:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster


Alignment Length:117 Identity:50/117 - (42%)
Similarity:64/117 - (54%) Gaps:12/117 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    75 KDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAEAYDVLSDPKKRGLYDQY 139
            ||||::||:...|.:.||||||:|:||:.||||||.|.|.|.||.:..|..||:|.:||..||.|
  Fly   105 KDYYEVLGVSKTATDSEIKKAYKKLALQLHPDKNKAPGAVEAFKALGNAAGVLTDAEKRKNYDLY 169

Human   140 GEEGLKTGGGTSGGS--------SGSFHYT--FHGDPHA--TFASFFGGSNP 179
            |......|.|.:||.        :..:.|:  |..|..|  .|..||.|..|
  Fly   170 GINESHNGHGNNGGGHHGHGQYYNNEYGYSRGFQADISAEELFNMFFNGGFP 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJB5NP_001128477.1 DnaJ_bact 76..415 CDD:274090 49/116 (42%)
CG3061NP_650328.1 DnaJ_bact 106..>220 CDD:274090 48/113 (42%)
DUF1977 264..364 CDD:462754
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.