DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB5 and CG11035

DIOPT Version :9

Sequence 1:NP_001128477.1 Gene:DNAJB5 / 25822 HGNCID:14887 Length:420 Species:Homo sapiens
Sequence 2:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster


Alignment Length:178 Identity:50/178 - (28%)
Similarity:75/178 - (42%) Gaps:50/178 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    77 YYKILGIPSGANEDEIKKAYRKMALKYHPDKNK-EPNAEEKFKEIAEAYDVLSDPKKRGLYDQYG 140
            :|..|||.....::|||.||.|:::.||||:|: ..||.:||:||.:||::|.:.:.|.|||   
  Fly    28 HYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYD--- 89

Human   141 EEGLKTGGGTSGGSSGSFHYTFHGDPHAT-------------FASFFGGSNPFDIFFASSRSTRP 192
             :|:....|..          :..|.|..             :.|.|..|...|     |....|
  Fly    90 -KGIVHTAGAQ----------YAQDVHDVAEPVVEDDAETKFYKSRFQKSRVSD-----SAGRTP 138

Human   193 FSGFDPDDMDVDEDEDPFG-AFGRFGFNGLSRGPRRAPEPLYPRRKVQ 239
            ...||      :...:.:| :|.|          |:|.:..|.|.|||
  Fly   139 IYDFD------EWSRNHYGKSFDR----------RQAAQAKYDRIKVQ 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJB5NP_001128477.1 DnaJ 72..415 CDD:223560 50/178 (28%)
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 26/60 (43%)
DnaJ 27..89 CDD:278647 26/60 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.