DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB5 and Dph4

DIOPT Version :10

Sequence 1:NP_001128477.1 Gene:DNAJB5 / 25822 HGNCID:14887 Length:420 Species:Homo sapiens
Sequence 2:NP_649559.1 Gene:Dph4 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster


Alignment Length:175 Identity:42/175 - (24%)
Similarity:69/175 - (39%) Gaps:68/175 - (38%)


- Green bases have known domain annotations that are detailed below.


Human    76 DYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKE-----PNAEEK---FKEIAEAYDVLSDPKK 132
            |:|::|.:||.|:.||||.:|:::.|:.||||.::     |.:|.:   |..|..|::.|.||.:
  Fly     3 DFYELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDPIR 67

Human   133 RGLYDQYGEEGLKTGGGTSGGSSGSFHYTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSGFD 197
            |..||   .|.|::            .:..|.:.:||..                     .|...
  Fly    68 RKHYD---AELLQS------------KFRAHSNIYATVV---------------------LSEMQ 96

Human   198 PDDMDVDEDEDPFGAFGRFGFNGLSRGPRRAPEPLYPRRKVQDPP 242
            ...::::||:|                  .||.|..|      ||
  Fly    97 RIQVEIEEDDD------------------EAPAPSAP------PP 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJB5NP_001128477.1 DnaJ_bact 76..415 CDD:274090 42/175 (24%)
Dph4NP_649559.1 DnaJ 3..72 CDD:395170 25/68 (37%)
zf-CSL <138..179 CDD:398744
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.