Sequence 1: | NP_001128477.1 | Gene: | DNAJB5 / 25822 | HGNCID: | 14887 | Length: | 420 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001287144.1 | Gene: | Csp / 40459 | FlyBaseID: | FBgn0004179 | Length: | 249 | Species: | Drosophila melanogaster |
Alignment Length: | 231 | Identity: | 63/231 - (27%) |
---|---|---|---|
Similarity: | 82/231 - (35%) | Gaps: | 94/231 - (40%) |
- Green bases have known domain annotations that are detailed below.
Human 70 VAVMGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKE-PNAEEKFKEIAEAYDVLSDPKKR 133
Human 134 GLYDQYGEEGLKTGGGTSGGSSGSFHYTFHGDPHATFASFFGGSNPFDIFFASSRS--------- 189
Human 190 ------------------------------------TRPFSGFDPDDM-----------DVDEDE 207
Human 208 DPFGAFGRFGFNGLSRGPRRAPEPLYPRRKVQDPPV 243 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DNAJB5 | NP_001128477.1 | DnaJ | 72..415 | CDD:223560 | 63/229 (28%) |
Csp | NP_001287144.1 | DnaJ | 17..>86 | CDD:223560 | 37/68 (54%) |
DnaJ | 17..79 | CDD:278647 | 33/61 (54%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |