DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB5 and CG7133

DIOPT Version :9

Sequence 1:NP_001128477.1 Gene:DNAJB5 / 25822 HGNCID:14887 Length:420 Species:Homo sapiens
Sequence 2:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster


Alignment Length:63 Identity:32/63 - (50%)
Similarity:47/63 - (74%) Gaps:2/63 - (3%)


- Green bases have known domain annotations that are detailed below.


Human    75 KDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAEAYDVLSDPKKRGLYD 137
            :|:|::||:|..|.:.|||.|:|:::|:|||||| |..|:| |..|.||:.||.|.::|.|||
  Fly     6 EDHYQVLGLPRNATDSEIKDAFRRLSLQYHPDKN-EDGAKE-FLRINEAHRVLIDHQRRALYD 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJB5NP_001128477.1 DnaJ 72..415 CDD:223560 32/63 (51%)
CG7133NP_649379.1 DnaJ 7..66 CDD:278647 30/60 (50%)
DnaJ 7..>66 CDD:223560 30/60 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.