DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB5 and DnaJ-1

DIOPT Version :9

Sequence 1:NP_001128477.1 Gene:DNAJB5 / 25822 HGNCID:14887 Length:420 Species:Homo sapiens
Sequence 2:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster


Alignment Length:361 Identity:183/361 - (50%)
Similarity:237/361 - (65%) Gaps:43/361 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    73 MGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAEAYDVLSDPKKRGLYD 137
            ||||:|||||:...|::|||||||||:||||||||||.|.|||:||||||||:||||.|||.::|
  Fly     1 MGKDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKRDIFD 65

Human   138 QYGEEGLKTG--GGTSGGSSGSFHYTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSG----- 195
            .|||:|||.|  |...||..|::.|.|||||.||||.|||.|:||..||....:.  |||     
  Fly    66 NYGEDGLKGGQPGPDGGGQPGAYTYQFHGDPRATFAQFFGSSDPFGAFFTGGDNM--FSGGQGGN 128

Human   196 -------FDPDDMDVDEDEDPFGAFGRFGFNGLSRGPRRAPEPLYPRRKVQDPPVVHELRVSLEE 253
                   ...|||              |.||.      :||.    |::.||||:.|:|.|||||
  Fly   129 TNEIFWNIGGDDM--------------FAFNA------QAPS----RKRQQDPPIEHDLFVSLEE 169

Human   254 IYHGSTKRMKITRRRLNPDGRTVRTEDKILHIVIKRGWKEGTKITFPKEGDATPDNIPADIVFVL 318
            :..|..|:|||:|.....:|  ...|:|:|.|.:|.|||.|||||||:|||:.|:..||||||::
  Fly   170 VDKGCIKKMKISRMATGSNG--PYKEEKVLRITVKPGWKAGTKITFPQEGDSAPNKTPADIVFII 232

Human   319 KDKPHAHFRRDGTNVLYSALISLKEALCGCTVNIPTIDG-RVIPLPCNDVIKPGTVKRLRGEGLP 382
            :||||:.|:|:|.::.|:|.||||:||||..|::||:.| |:...|.:::|||.|.:|:.|.|||
  Fly   233 RDKPHSLFKREGIDLKYTAQISLKQALCGALVSVPTLQGSRIQVNPNHEIIKPTTTRRINGLGLP 297

Human   383 FPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQHLP 418
            .||.|::||||||.|.::|||.|.|..:..|.:.||
  Fly   298 VPKEPSRRGDLIVSFDIKFPDTLAPSLQNQLSELLP 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJB5NP_001128477.1 DnaJ 72..415 CDD:223560 181/356 (51%)
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 181/359 (50%)
DnaJ 4..65 CDD:278647 45/60 (75%)
DnaJ_C 157..320 CDD:199909 86/164 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154096
Domainoid 1 1.000 190 1.000 Domainoid score I3265
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 371 1.000 Inparanoid score I2129
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 1 1.000 - - mtm8440
orthoMCL 1 0.900 - - OOG6_100302
Panther 1 1.100 - - O PTHR24078
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X227
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.770

Return to query results.
Submit another query.