DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB5 and shv

DIOPT Version :9

Sequence 1:NP_001128477.1 Gene:DNAJB5 / 25822 HGNCID:14887 Length:420 Species:Homo sapiens
Sequence 2:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster


Alignment Length:386 Identity:119/386 - (30%)
Similarity:178/386 - (46%) Gaps:108/386 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    74 GKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNK-EPNAEEKFKEIAEAYDVLSDPKKRGLYD 137
            |:|:||||.:...||.:|:|||||::|.:.|||||| :|:|..||:::..||:|||:|.||..||
  Fly    23 GRDFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTKFQDLGAAYEVLSNPDKRKTYD 87

Human   138 QYGEEGLKTGGGTSGGSSGSFHYTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSGFDPDDMD 202
            :.|||.||..|....|          |||   |:||||.                          
  Fly    88 RCGEECLKKEGMMDHG----------GDP---FSSFFGD-------------------------- 113

Human   203 VDEDEDPFGAFG-RFGFNGLSRGPRRAPEPLYPRRKVQDPP----VVHELRVSLEEIYHGS---- 258
                      || .||.:|                :.||.|    :|.:|.|||||:|.|:    
  Fly   114 ----------FGFHFGGDG----------------QQQDAPRGADIVMDLYVSLEELYSGNFVEI 152

Human   259 ------TK----------RMKITRRRLNPDGR---------------TVRTEDKILHIVIKRGWK 292
                  ||          |.::..|.|.| ||               .:..|::.|.|.:::|..
  Fly   153 VRNKPVTKPASGTRKCNCRQEMVTRNLGP-GRFQMIQQTVCDECPNVKLVNEERTLEIEVEQGMV 216

Human   293 EGTKITFPKEGDATPDNIPADIVFVLKDKPHAHFRRDGTNVLYSALISLKEALCGCTVNIPTIDG 357
            :|.:..|..||:...|..|.|::..::..||..|.|...::..:..|||::||.|.::.|..:||
  Fly   217 DGQETRFVAEGEPHIDGEPGDLIVRVQQMPHPRFLRKNDDLYTNVTISLQDALVGFSMEIKHLDG 281

Human   358 RVIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDR-LTPQTRQILKQHL 417
            .::|:....|..||...|.:|||:|..:.....|:|.:.|.|.||.: ||.:.::.||:.|
  Fly   282 HLVPVTREKVTWPGARIRKKGEGMPNFENNNLTGNLYITFDVEFPKKDLTEEDKEALKKIL 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJB5NP_001128477.1 DnaJ 72..415 CDD:223560 117/382 (31%)
shvNP_608525.1 DnaJ 22..346 CDD:223560 119/386 (31%)
DnaJ 25..87 CDD:278647 32/61 (52%)
DnaJ_C 131..328 CDD:199909 56/197 (28%)
DnaJ_zf 160..>195 CDD:304418 7/35 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.