DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB5 and CG30156

DIOPT Version :10

Sequence 1:NP_001128477.1 Gene:DNAJB5 / 25822 HGNCID:14887 Length:420 Species:Homo sapiens
Sequence 2:NP_724520.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster


Alignment Length:121 Identity:41/121 - (33%)
Similarity:64/121 - (52%) Gaps:15/121 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    75 KDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAEAYDVLSDPKKRGLYDQY 139
            :::|::|.|...|...|:|:||.|:||:.||||||.|.||:.|:.|:||.|.|:|.:||..|:  
  Fly    95 RNHYEVLRISHHATYSEVKRAYHKLALRLHPDKNKSPGAEQAFRRISEAADCLTDCQKRIEYN-- 157

Human   140 GEEGLKTGGGTSGGSSGSFHYTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSG 195
                :.|..|.......|.:..:.|:      |.|..:|..|:   .:...||:.|
  Fly   158 ----IATAVGDCHDQDPSQYKDYRGE------SEFNEANGNDL---GAAFRRPYRG 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJB5NP_001128477.1 DnaJ_bact 76..415 CDD:274090 41/120 (34%)
CG30156NP_724520.1 PRK14296 95..>227 CDD:237666 41/121 (34%)
DnaJ 96..157 CDD:395170 29/60 (48%)
DUF1977 238..334 CDD:462754
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.