DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KLK5 and CG11836

DIOPT Version :10

Sequence 1:NP_036559.1 Gene:KLK5 / 25818 HGNCID:6366 Length:293 Species:Homo sapiens
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:164 Identity:33/164 - (20%)
Similarity:51/164 - (31%) Gaps:68/164 - (41%)


- Green bases have known domain annotations that are detailed below.


Human   158 TGTGTGGESFWGKPFKDEFRPNLSHTGRGVLSMANSGPNTNKSQFFITFRSCAYLDKKHTIFGRV 222
            :.:.:||....|.        ||.|      |::::.|:|..|..     |.:..|.||      
  Fly    44 SNSSSGGTPACGS--------NLVH------SLSSATPSTGGSSI-----SDSGSDSKH------ 83

Human   223 VGGFDTLTAMENVESDPKTDRPKEEVLICTTTVFVDPYEEADAQIAQERKKTQHQVDPEAKVKMS 287
                                 |.:.:    :|..|||:     |:.|.|.       |..||...
  Fly    84 ---------------------PTDSI----STPSVDPH-----QLLQSRM-------PNIKVFSG 111

Human   288 QPQPGNQGPQTYRQGV--GKYIHPAATKRSAEEE 319
            ...|........|.|:  ||.:    ||:.:..|
  Fly   112 SSHPDLASRIVDRLGIDLGKVV----TKKFSNLE 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KLK5NP_036559.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..68
Tryp_SPc 66..285 CDD:214473 24/126 (19%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 14/56 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.