DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KLK5 and CG32271

DIOPT Version :10

Sequence 1:NP_036559.1 Gene:KLK5 / 25818 HGNCID:6366 Length:293 Species:Homo sapiens
Sequence 2:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster


Alignment Length:133 Identity:29/133 - (21%)
Similarity:48/133 - (36%) Gaps:53/133 - (39%)


- Green bases have known domain annotations that are detailed below.


Human   145 RSIRNFVIQGGDPTGTGTGGESFWGKPFKDEFRPNLSHTGRGVLSMANSGPNTNKSQFF----IT 205
            :||:|| .:..||:||..|..           :|..:||   .|..||:..:.:..|..    ||
  Fly   183 KSIQNF-YKIPDPSGTKIGVP-----------KPKETHT---KLRQANNQTSADSQQMIEEAAIT 232

Human   206 FRSCAYLDKKHTIFGRVVGGFDTLTAMENVESDPKTDRPKEEVLICTTTVFVDPYEEADAQIAQE 270
                                    .|.:.||::.|.|..|         :..:.:|:. .:||:|
  Fly   233 ------------------------AACKVVEAENKIDVAK---------LAAEEFEKM-TKIAEE 263

Human   271 RKK 273
            .:|
  Fly   264 NRK 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KLK5NP_036559.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..68
Tryp_SPc 66..285 CDD:214473 29/133 (22%)
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 21/97 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.