DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KLK5 and CG6048

DIOPT Version :10

Sequence 1:NP_036559.1 Gene:KLK5 / 25818 HGNCID:6366 Length:293 Species:Homo sapiens
Sequence 2:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster


Alignment Length:174 Identity:41/174 - (23%)
Similarity:56/174 - (32%) Gaps:64/174 - (36%)


- Green bases have known domain annotations that are detailed below.


Human    85 AAVIDEDVLRYQFVKKKGYVRLHTNKGDLNLELHCDLTPKTCENFIKLCKK--QYYDGTIFHRSI 147
            :.:|.||..    .||.|.:.|...           :.|:.|.     |.|  |....|||.:..
  Fly   153 STIIGEDTT----TKKSGGITLPPT-----------VLPEDCN-----CSKPPQLITQTIFDKQY 197

Human   148 R-NFVIQGGDPTGTGTGGESFWGKPFKDEFRPNLSHT-GRGVLSMANSGPNTNKSQFFITFRSCA 210
            . ||      |....|.|            .|:.::| |...:||..|     .||..|.|.:..
  Fly   198 AFNF------PQTKFTFG------------TPSFTYTVGCQHVSMICS-----SSQKAIMFFNDQ 239

Human   211 YLDKKHTIFGRVVGGFDTL--TAMENVESDP-----KTDRPKEE 247
            |          ::.|.|.|  .|..|:..|.     |.|.|.|:
  Fly   240 Y----------IINGNDILDVAAKYNLHCDSGVAKWKFDEPSEQ 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KLK5NP_036559.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..68
Tryp_SPc 66..285 CDD:214473 41/174 (24%)
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 41/174 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.