DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SVIP and svip

DIOPT Version :10

Sequence 1:NP_001307269.1 Gene:SVIP / 258010 HGNCID:25238 Length:79 Species:Homo sapiens
Sequence 2:XP_073797733.1 Gene:svip / 100006207 ZFINID:ZDB-GENE-131127-226 Length:84 Species:Danio rerio


Alignment Length:58 Identity:30/58 - (51%)
Similarity:42/58 - (72%) Gaps:0/58 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    21 EEKRAKLAEAAERRQKEAASRGILDVQSVQEKRKKKEKIEKQIATSGPPPEGGLRWTV 78
            |.:|.:||||||:||||...|||.|.::::.|:||:|:.|||..:|.|...|||:|.|
Zfish    26 ETRRKQLAEAAEKRQKETTYRGIKDPEALERKKKKQEESEKQTMSSAPSGGGGLKWQV 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SVIPNP_001307269.1 SVIP 12..75 CDD:464888 27/53 (51%)
svipXP_073797733.1 None

Return to query results.
Submit another query.