DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GCA and CG17765

DIOPT Version :9

Sequence 1:XP_006712461.1 Gene:GCA / 25801 HGNCID:15990 Length:259 Species:Homo sapiens
Sequence 2:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster


Alignment Length:198 Identity:64/198 - (32%)
Similarity:101/198 - (51%) Gaps:17/198 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    46 MQMGQ---PVPETGPAILLDGYSGP--AYSDTYSSAGDSVYTYFSAV-AGQDGEVDAEELQRCLT 104
            |..||   |..:.|     .||:.|  |:....:........:||.| ..:.|:::|.|||..| 
  Fly     1 MSYGQGYNPYAQPG-----GGYAPPPGAFPPQNAQVSPQAQQWFSMVDRDRSGKINASELQAAL- 59

Human   105 QSGINGTYSPFSLETCRIMIAMLDRDHTGKMGFNAFKELWAALNAWKENFMTVDQDGSGTVEHHE 169
               :||....||...|::||:|.|.|.:|.:....|::|:..:|.|.:.|.|.|||.||.:|..|
  Fly    60 ---VNGRGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIEEQE 121

Human   170 LRQAIGLMGYRLSPQTLTTIVKRYSKNG--RIFFDDYVACCVKLRALTDFFRKRDHLQQGSANFI 232
            |.||...||:|.||:.:..:||:....|  .:..|.::..||:::..|:.||:||..|.|:....
  Fly   122 LTQAFTQMGFRFSPEFINFLVKKSDPQGHKEVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIG 186

Human   233 YDD 235
            ::|
  Fly   187 FED 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GCAXP_006712461.1 EFh 90..145 CDD:298682 19/54 (35%)
EFh 120..174 CDD:298682 22/53 (42%)
EF-hand_7 151..206 CDD:290234 21/56 (38%)
EFh 151..206 CDD:298682 21/56 (38%)
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 45/139 (32%)
EFh 39..92 CDD:238008 20/56 (36%)
EFh 105..159 CDD:298682 21/53 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0037
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54126
OrthoDB 1 1.010 - - D1330600at2759
OrthoFinder 1 1.000 - - FOG0000697
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100410
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.