Sequence 1: | XP_006712461.1 | Gene: | GCA / 25801 | HGNCID: | 15990 | Length: | 259 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_610592.1 | Gene: | CG17765 / 36111 | FlyBaseID: | FBgn0033529 | Length: | 199 | Species: | Drosophila melanogaster |
Alignment Length: | 198 | Identity: | 64/198 - (32%) |
---|---|---|---|
Similarity: | 101/198 - (51%) | Gaps: | 17/198 - (8%) |
- Green bases have known domain annotations that are detailed below.
Human 46 MQMGQ---PVPETGPAILLDGYSGP--AYSDTYSSAGDSVYTYFSAV-AGQDGEVDAEELQRCLT 104
Human 105 QSGINGTYSPFSLETCRIMIAMLDRDHTGKMGFNAFKELWAALNAWKENFMTVDQDGSGTVEHHE 169
Human 170 LRQAIGLMGYRLSPQTLTTIVKRYSKNG--RIFFDDYVACCVKLRALTDFFRKRDHLQQGSANFI 232
Human 233 YDD 235 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GCA | XP_006712461.1 | EFh | 90..145 | CDD:298682 | 19/54 (35%) |
EFh | 120..174 | CDD:298682 | 22/53 (42%) | ||
EF-hand_7 | 151..206 | CDD:290234 | 21/56 (38%) | ||
EFh | 151..206 | CDD:298682 | 21/56 (38%) | ||
CG17765 | NP_610592.1 | FRQ1 | 26..162 | CDD:227455 | 45/139 (32%) |
EFh | 39..92 | CDD:238008 | 20/56 (36%) | ||
EFh | 105..159 | CDD:298682 | 21/53 (40%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0037 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG54126 | |
OrthoDB | 1 | 1.010 | - | - | D1330600at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000697 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_100410 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.730 |