DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC39A6 and Zip99C

DIOPT Version :9

Sequence 1:NP_036451.4 Gene:SLC39A6 / 25800 HGNCID:18607 Length:755 Species:Homo sapiens
Sequence 2:NP_001189313.1 Gene:Zip99C / 43533 FlyBaseID:FBgn0039714 Length:355 Species:Drosophila melanogaster


Alignment Length:462 Identity:96/462 - (20%)
Similarity:172/462 - (37%) Gaps:128/462 - (27%)


- Green bases have known domain annotations that are detailed below.


Human   299 DARSCLIHTSEKKAEIPPKTYSLQIA-WVGGFIAISIISFLSLLGVILVPL---MNRVFFK---- 355
            |....:|:::.....:|....|.:.. ||...:...:|....:..:|::|.   |.:..:|    
  Fly     9 DEHIAMIYSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSGIFPLIIIPTEEKMAKEGYKDPAD 73

Human   356 -FLLSFLVALAVGTLSGDAFLHLLPHSHASHHHSHSHEEPAMEMKRGPLFSHLSSQNIEESAYFD 419
             .||..|::.|||.|.||.||||||.:...     .:::|:         ||.|.::        
  Fly    74 SKLLRVLLSFAVGGLLGDVFLHLLPEAWEG-----DNQDPS---------SHPSLRS-------- 116

Human   420 STWKGLTALGGLYFMFLVEHVLTLIKQFKDKKKKNQKKPENDDDVEIKKQLSKYESQLSTNEEKV 484
                ||..|.|:....:||.:.:                                          
  Fly   117 ----GLWVLSGILIFTIVEKIFS------------------------------------------ 135

Human   485 DTDDRTEGYLRADSQEPSHFDSQQPAVLEEEEVMIAHAHPQEVYNEYVPRGCKNKCHSHFHDTLG 549
                   ||..||.:.|      ||..:|....:: ..|..::........|...|..   :.:|
  Fly   136 -------GYASADEENP------QPKCVEIANCLL-RRHGGQLPEGETSESCGGACDI---EDVG 183

Human   550 QSDDLIHHHHDYHHILHHHHHQNHHPHSHSQRYSREELKDAGVATLAWMVIMGDGLHNFSDGLAI 614
            :...|                       ..|....:|.|:.......::.::.:.:.||:.|||:
  Fly   184 KVCFL-----------------------REQEQKSKERKEQPKKVAGYLNLLANSIDNFTHGLAV 225

Human   615 GAAFTEGLSSGLSTSVAVFCHELPHELGDFAVLLKAGMT---VKQAVLYNALSAMLAYLGMATGI 676
            ..:|......|:..:.|:..||:|||:||||:||::|.:   ..:|.|..|.:.:|..|....|.
  Fly   226 AGSFLVSFRHGILATFAILLHEIPHEVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGS 290

Human   677 FIGHYAENVSMWIFALTAGLFMYVALVDMVPEMLHNDASDHGCSRWGYFFLQNAGMLLGFGIMLL 741
            .:....|..:.||...|||.|:::|||.::|::|..:.......       |...::.|..:|.:
  Fly   291 GVTSAMEARTSWIMPFTAGGFLHIALVTVLPDLLKEEERKESIK-------QLLALVFGIALMAV 348

Human   742 IS-IFEH 747
            :: :|||
  Fly   349 MTMLFEH 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC39A6NP_036451.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..186
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..246
Zip 323..742 CDD:308248 89/430 (21%)
Zip99CNP_001189313.1 Zip 34..350 CDD:280666 89/430 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0428
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D657777at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.