DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC39A6 and Zip48C

DIOPT Version :9

Sequence 1:NP_036451.4 Gene:SLC39A6 / 25800 HGNCID:18607 Length:755 Species:Homo sapiens
Sequence 2:NP_610712.1 Gene:Zip48C / 36273 FlyBaseID:FBgn0033665 Length:341 Species:Drosophila melanogaster


Alignment Length:172 Identity:42/172 - (24%)
Similarity:75/172 - (43%) Gaps:23/172 - (13%)


- Green bases have known domain annotations that are detailed below.


Human   585 EELKDAGVATLAW----MVIMGDGLHNFSDGLAIGAAF-------TEGLSSGLSTSVAVFCHELP 638
            ||.:.|..|...|    ::::...:||..:|||:|.:|       :....|..:.::.:.....|
  Fly   178 EEQQRAEDALSQWKRIMLLVVAITVHNIPEGLAVGVSFGAIGSTNSSTFESARNLAIGIGIQNFP 242

Human   639 HELGDFAVLLKAGMTVKQAVLYNALSAMLAYLGMATGIFIGHYAENVSMWIFALTAGLFMYVALV 703
            ..|.....|..||.:||:|:.|..||.|:..:....|.....:|..:..:..:..||..:|:...
  Fly   243 EGLAVSLPLHAAGFSVKRALWYGQLSGMVEPIFGVLGAVAVTFANLILPYALSFAAGAMIYIVSD 307

Human   704 DMVPEMLHNDASDHG-CSRWGYFFLQNAGMLLGFGIMLLISI 744
            |::||.   .||.:| .:.|        |.:.||.||:.:.:
  Fly   308 DILPEA---HASGNGTIATW--------GTVSGFLIMMCLEV 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC39A6NP_036451.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..186
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..246
Zip 323..742 CDD:308248 42/168 (25%)
Zip48CNP_610712.1 ZupT 23..340 CDD:223505 42/172 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0428
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.