| Sequence 1: | NP_036311.3 | Gene: | FBXO7 / 25793 | HGNCID: | 13586 | Length: | 522 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_496207.1 | Gene: | mec-15 / 174587 | WormBaseID: | WBGene00003177 | Length: | 406 | Species: | Caenorhabditis elegans |
| Alignment Length: | 104 | Identity: | 27/104 - (25%) |
|---|---|---|---|
| Similarity: | 45/104 - (43%) | Gaps: | 19/104 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Human 332 LVVLPLELKLRIFRLLDVRSVLS-LSAVCRDLFTASNDPLLWRFLYLRDFR-DNTVRVQDTDWKE 394
Human 395 -----------LYRKRHIQRKESPKGRFVMLLPSSTHTI 422 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| FBXO7 | NP_036311.3 | Ubiquitin-like | 1..88 | ||
| Ubl1_cv_Nsp3_N-like | 1..77 | CDD:475130 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 85..144 | ||||
| Important for interaction with PINK1. /evidence=ECO:0000269|PubMed:23933751 | 92..129 | ||||
| Important for interaction with CDK6 | 129..169 | ||||
| Important for dimerization and interaction with PSMF1. /evidence=ECO:0000269|PubMed:18495667 | 180..324 | ||||
| PI31_Prot_N | 189..317 | CDD:463296 | |||
| F-box_FBXO7 | 332..376 | CDD:438859 | 15/44 (34%) | ||
| Important for interaction with CDK6 | 381..522 | 11/54 (20%) | |||
| PHA03247 | <431..520 | CDD:223021 | |||
| RFDP motif | 481..484 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 483..522 | ||||
| mec-15 | NP_496207.1 | F-box_SF | 9..57 | CDD:459239 | 17/51 (33%) |
| WD40 | 88..322 | CDD:475233 | 3/19 (16%) | ||
| WD40 repeat | 106..154 | CDD:293791 | 0/1 (0%) | ||
| WD40 repeat | 162..197 | CDD:293791 | |||
| WD40 repeat | 204..241 | CDD:293791 | |||
| WD40 repeat | 247..286 | CDD:293791 | |||
| WD40 repeat | 290..310 | CDD:293791 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||