DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FBXO7 and mec-15

DIOPT Version :10

Sequence 1:NP_036311.3 Gene:FBXO7 / 25793 HGNCID:13586 Length:522 Species:Homo sapiens
Sequence 2:NP_496207.1 Gene:mec-15 / 174587 WormBaseID:WBGene00003177 Length:406 Species:Caenorhabditis elegans


Alignment Length:104 Identity:27/104 - (25%)
Similarity:45/104 - (43%) Gaps:19/104 - (18%)


- Green bases have known domain annotations that are detailed below.


Human   332 LVVLPLELKLRIFRLLDVRSVLS-LSAVCRDLFTASNDPLLWRFLYLRDFR-DNTVRVQDTDWKE 394
            |:.||.||...:|..|..|.::: :..|||...|..||...|.    |..| :..||:.|.:.|.
 Worm     9 LISLPSELLCHLFTYLPQRQLITEIPLVCRRFNTILNDDKFWS----RRIRTEQKVRLPDCELKH 69

Human   395 -----------LYRKRHIQRKESPKGRFVMLLPSSTHTI 422
                       ::|:|  .|..:.:.:.|:..|..:.|:
 Worm    70 PEYEPKKSFYAMHRQR--DRWRAWETQTVITAPGHSATV 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FBXO7NP_036311.3 Ubiquitin-like 1..88
Ubl1_cv_Nsp3_N-like 1..77 CDD:475130
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..144
Important for interaction with PINK1. /evidence=ECO:0000269|PubMed:23933751 92..129
Important for interaction with CDK6 129..169
Important for dimerization and interaction with PSMF1. /evidence=ECO:0000269|PubMed:18495667 180..324
PI31_Prot_N 189..317 CDD:463296
F-box_FBXO7 332..376 CDD:438859 15/44 (34%)
Important for interaction with CDK6 381..522 11/54 (20%)
PHA03247 <431..520 CDD:223021
RFDP motif 481..484
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 483..522
mec-15NP_496207.1 F-box_SF 9..57 CDD:459239 17/51 (33%)
WD40 88..322 CDD:475233 3/19 (16%)
WD40 repeat 106..154 CDD:293791 0/1 (0%)
WD40 repeat 162..197 CDD:293791
WD40 repeat 204..241 CDD:293791
WD40 repeat 247..286 CDD:293791
WD40 repeat 290..310 CDD:293791
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.