DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HYPK and CG9922

DIOPT Version :10

Sequence 1:NP_057484.4 Gene:HYPK / 25764 HGNCID:18418 Length:121 Species:Homo sapiens
Sequence 2:NP_650329.1 Gene:CG9922 / 41708 FlyBaseID:FBgn0038196 Length:124 Species:Drosophila melanogaster


Alignment Length:110 Identity:54/110 - (49%)
Similarity:79/110 - (71%) Gaps:0/110 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    10 ELETETSGPERPPEKPRKHDSGAADLERVTDYAEEKEIQSSNLETAMSVIGDRRSREQKAKQERE 74
            |:|.:....::.....::||.|||||||||||||||||.:.|:.:|:...|::|::|.:.:..:|
  Fly    12 EVEDDEQDKKQKKSDVKRHDDGAADLERVTDYAEEKEISADNISSAVEQFGNQRNKENELRVAKE 76

Human    75 KELAKVTIKKEDLELIMTEMEISRAAAERSLREHMGNVVEALIAL 119
            |||.||.:||||:||||.|:.:|:|.||:.|||..|:||.||.|:
  Fly    77 KELQKVQVKKEDIELIMNELLVSKAHAEKVLREQSGDVVAALEAI 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HYPKNP_057484.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..75 26/64 (41%)
Required for association with the NAA10-NAA15 complex. /evidence=ECO:0000269|PubMed:29754825 52..121 32/68 (47%)
HYPK_UBA 80..120 CDD:436907 23/40 (58%)
CG9922NP_650329.1 UBA_HYPK 82..122 CDD:270544 23/40 (58%)

Return to query results.
Submit another query.