DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNX33 and YPT35

DIOPT Version :10

Sequence 1:NP_695003.1 Gene:SNX33 / 257364 HGNCID:28468 Length:574 Species:Homo sapiens
Sequence 2:NP_011973.1 Gene:YPT35 / 856505 SGDID:S000001147 Length:214 Species:Saccharomyces cerevisiae


Alignment Length:120 Identity:28/120 - (23%)
Similarity:51/120 - (42%) Gaps:37/120 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   228 HPFACSVEDPTKQTKF----------KGIKSYI----SYKLTPTHAASPVYRRYKHFDWLYNRLL 278
            |...|::.:....|||          ..:|::.    |||:       ..|:||..|..|...||
Yeast    77 HVSDCTIVNGDHGTKFAVWRITVFLEPNLKAFAAKRESYKI-------QTYKRYSDFVRLRENLL 134

Human   279 --------HKFTVISVPHLP---EKQATGRFEE-----DFIEKRKRRLILWMDHM 317
                    .|...:.:||||   :..::.:::|     |::.||:|.|..:::|:
Yeast   135 TRIKTAKPEKLNCLQIPHLPPSVQWYSSWKYQEVNLNKDWLAKRQRGLEYFLNHI 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNX33NP_695003.1 SH3_SNX33 4..58 CDD:212829
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..119
PX_domain 230..354 CDD:470617 27/118 (23%)
BAR_SNX33 365..571 CDD:153353
YPT35NP_011973.1 PX_YPT35 73..209 CDD:132813 28/120 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.