DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNX33 and SNX3

DIOPT Version :10

Sequence 1:NP_695003.1 Gene:SNX33 / 257364 HGNCID:28468 Length:574 Species:Homo sapiens
Sequence 2:NP_015002.3 Gene:SNX3 / 854539 SGDID:S000005884 Length:162 Species:Saccharomyces cerevisiae


Alignment Length:69 Identity:24/69 - (34%)
Similarity:39/69 - (56%) Gaps:6/69 - (8%)


- Green bases have known domain annotations that are detailed below.


Human   261 SPVYRRYKHFDWLYNRLLHKFTVIS-----VPHLPEK-QATGRFEEDFIEKRKRRLILWMDHMTS 319
            |.|.|||..|::....|:.:.::::     |||||.| ..:.||..:.||:|::.|..||..:..
Yeast    76 SKVRRRYSDFEFFRKCLIKEISMLNHPKVMVPHLPGKILLSNRFSNEVIEERRQGLNTWMQSVAG 140

Human   320 HPVL 323
            ||:|
Yeast   141 HPLL 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNX33NP_695003.1 SH3_SNX33 4..58 CDD:212829
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..119
PX_domain 230..354 CDD:470617 24/69 (35%)
BAR_SNX33 365..571 CDD:153353
SNX3NP_015002.3 PX_Grd19 35..160 CDD:132828 24/69 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.