DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEGR1 and Negr1

DIOPT Version :9

Sequence 1:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens
Sequence 2:XP_038958934.1 Gene:Negr1 / 59318 RGDID:708416 Length:362 Species:Rattus norvegicus


Alignment Length:366 Identity:333/366 - (90%)
Similarity:340/366 - (92%) Gaps:18/366 - (4%)


- Green bases have known domain annotations that are detailed below.


Human     3 MMLLVQGACCSNQWLAAVLLSLCCLLPSCLPAGQSVDFPWAAVDNMMVRKGDTAVLRCYLEDGAS 67
            |:||.||||||||||||||||||    |||||||||||||||||||:||||||||||||||||||
  Rat     1 MVLLAQGACCSNQWLAAVLLSLC----SCLPAGQSVDFPWAAVDNMLVRKGDTAVLRCYLEDGAS 61

Human    68 KGAWLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSVQTQHTPRTMQVH 132
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat    62 KGAWLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSVQTQHTPRTMQVH 126

Human   133 LTVQVPPKIYDISNDMTVNEGTNVTLTCLATGKPEPSISWRHISPSAKPFENGQYLDIYGITRDQ 197
            |||||||||||||||||:||||||||||||||||||:||||||||||||||||||||||||||||
  Rat   127 LTVQVPPKIYDISNDMTINEGTNVTLTCLATGKPEPAISWRHISPSAKPFENGQYLDIYGITRDQ 191

Human   198 AGEYECSAENDVSFPDVRKVKVVVNFAPTIQEIKSGTVTPGRSGLIRCEGAGVPPPAFEWYKGEK 262
            |||||||||||||||||:||:||||||||||||||||||||||||||||||||||||||||||||
  Rat   192 AGEYECSAENDVSFPDVKKVRVVVNFAPTIQEIKSGTVTPGRSGLIRCEGAGVPPPAFEWYKGEK 256

Human   263 KLFNGQQGIIIQNFSTRSILTVTNVTQEHFGNYTCVAANKLGTTNASLPLN-------------- 313
            :||||||||||||||||||||||||||||||||||||||||||||||||||              
  Rat   257 RLFNGQQGIIIQNFSTRSILTVTNVTQEHFGNYTCVAANKLGTTNASLPLNQIIEPTTSSPVTSP 321

Human   314 PPSTAQYGITGSADVLFSCWYLVLTLSSFTSIFYLKNAILQ 354
            .||||||||||||..|||||.|.|||||..|||||||||||
  Rat   322 APSTAQYGITGSACDLFSCWSLALTLSSVISIFYLKNAILQ 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEGR1NP_776169.2 IG 47..135 CDD:214652 86/87 (99%)
IGc2 152..210 CDD:197706 56/57 (98%)
Ig_3 225..301 CDD:372822 74/75 (99%)
Negr1XP_038958934.1 FR1 38..55 CDD:409353 15/16 (94%)
Ig strand A' 40..46 CDD:409353 4/5 (80%)
IG_like 41..129 CDD:214653 86/87 (99%)
Ig strand B 48..56 CDD:409353 7/7 (100%)
CDR1 56..60 CDD:409353 3/3 (100%)
FR2 61..68 CDD:409353 6/6 (100%)
Ig strand C 61..67 CDD:409353 5/5 (100%)
CDR2 69..79 CDD:409353 9/9 (100%)
Ig strand C' 71..74 CDD:409353 2/2 (100%)
Ig strand C' 76..79 CDD:409353 2/2 (100%)
FR3 80..115 CDD:409353 34/34 (100%)
Ig strand D 84..91 CDD:409353 6/6 (100%)
Ig strand E 94..100 CDD:409353 5/5 (100%)
Ig strand F 107..115 CDD:409353 7/7 (100%)
CDR3 116..120 CDD:409353 3/3 (100%)
Ig strand G 120..129 CDD:409353 8/8 (100%)
FR4 122..129 CDD:409353 6/6 (100%)
Ig strand A' 139..144 CDD:409353 4/4 (100%)
IGc2 146..204 CDD:197706 56/57 (98%)
Ig strand B 150..157 CDD:409353 6/6 (100%)
Ig strand C 163..168 CDD:409353 3/4 (75%)
Ig strand C' 170..172 CDD:409353 1/1 (100%)
Ig strand E 180..186 CDD:409353 5/5 (100%)
Ig strand F 193..200 CDD:409353 6/6 (100%)
Ig strand G 207..215 CDD:409353 5/7 (71%)
Ig_3 219..295 CDD:404760 74/75 (99%)
putative Ig strand A 219..225 CDD:409353 5/5 (100%)
Ig strand B 235..239 CDD:409353 3/3 (100%)
Ig strand C 248..252 CDD:409353 3/3 (100%)
Ig strand E 274..278 CDD:409353 3/3 (100%)
Ig strand F 288..293 CDD:409353 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83677595
Domainoid 1 1.000 187 1.000 Domainoid score I26070
eggNOG 00.000 Not matched by this tool.
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41447
Inparanoid 1 1.050 684 1.000 Inparanoid score I9015
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG43105
OrthoDB 1 1.010 - - D125599at9347
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - oto132675
orthoMCL 1 0.900 - - OOG6_112728
Panther 1 1.100 - - LDO PTHR42757
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X97
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1616.410

Return to query results.
Submit another query.