DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEGR1 and DIP-delta

DIOPT Version :10

Sequence 1:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens
Sequence 2:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster


Alignment Length:310 Identity:91/310 - (29%)
Similarity:127/310 - (40%) Gaps:43/310 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    45 VDNMMVRKGDTAVLRCYLED-GASKGAW--LNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQ 106
            :.|:.|..|..|.|.|.:|. |..|.||  ::|..|:.......|..||.|| |.....:.|.:.
  Fly    50 IPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSI-TYTDNTWLLHVN 113

Human   107 NVDVTDDGPYTCSVQTQHTPRTMQV-HLTVQVPPKIYDIS---NDMTVNEGTNVTLTCLATGKPE 167
            .....|.|.|.|.|.|  .|...|| :|.|.|||.|.||.   :.:.|.|..|:.:||.|.|.|.
  Fly   114 QAHQDDRGYYMCQVNT--NPMISQVGYLQVVVPPNILDIESTPSSVAVRENQNINMTCRADGFPA 176

Human   168 PSISWRHISPSAKPFENGQYLDIYG--------ITRDQAGEYECSAENDVSFPDV-RKVKVVVNF 223
            |.|.||.........|..:.:.:|.        ::|::.|.|.|.|.|.|. |.| :::.:.|.|
  Fly   177 PKIIWRREDGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVP-PSVSKRIILDVEF 240

Human   224 APTIQEIKSGTVTP-GRSGLIRCEGAGVPPPAFEWYKGEKKLFNGQQGIIIQNFST--------- 278
            :|.|.........| |....|.|.....|.....|      ::|....:..:.:.|         
  Fly   241 SPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYW------VYNSVMVLPSKKYKTDYTENSYRA 299

Human   279 RSILTVTNVTQEHFGNYTCVAANKLGTTNAS-----LPLNPPSTAQYGIT 323
            ...||:.|:....||||.|::.|.||.|..|     :||  |||....:|
  Fly   300 HMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPL--PSTPSKQVT 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEGR1NP_776169.2 IG_like 47..135 CDD:214653 30/91 (33%)
Ig strand B 56..60 CDD:409353 2/3 (67%)
Ig strand C 68..72 CDD:409353 3/5 (60%)
Ig strand E 101..105 CDD:409353 1/3 (33%)
Ig strand F 115..120 CDD:409353 2/4 (50%)
Ig strand G 128..131 CDD:409353 0/2 (0%)
Ig_3 138..207 CDD:464046 24/79 (30%)
IG_like 231..312 CDD:214653 21/95 (22%)
Ig strand B 241..245 CDD:409353 1/3 (33%)
Ig strand C 254..258 CDD:409353 0/3 (0%)
Ig strand E 280..284 CDD:409353 1/3 (33%)
Ig strand F 294..299 CDD:409353 3/4 (75%)
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 31/94 (33%)
Ig strand B 61..65 CDD:409353 2/3 (67%)
Ig strand C 74..78 CDD:409353 2/3 (67%)
Ig strand E 105..112 CDD:409353 1/6 (17%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 134..137 CDD:409353 1/2 (50%)
Ig 145..238 CDD:472250 27/93 (29%)
Ig strand B 165..169 CDD:409353 0/3 (0%)
Ig strand C 178..182 CDD:409353 1/3 (33%)
Ig strand E 203..207 CDD:409353 0/3 (0%)
Ig strand F 217..222 CDD:409353 2/4 (50%)
Ig strand G 231..234 CDD:409353 0/2 (0%)
Ig 242..333 CDD:472250 23/96 (24%)
Ig strand B 259..263 CDD:409353 1/3 (33%)
Ig strand C 272..276 CDD:409353 1/9 (11%)
Ig strand E 295..305 CDD:409353 1/9 (11%)
Ig strand F 315..320 CDD:409353 3/4 (75%)
Ig strand G 328..331 CDD:409353 0/2 (0%)

Return to query results.
Submit another query.