DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEGR1 and dpr12

DIOPT Version :10

Sequence 1:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens
Sequence 2:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster


Alignment Length:195 Identity:48/195 - (24%)
Similarity:75/195 - (38%) Gaps:43/195 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    47 NMMVRKGDTAVLRCYLEDGASKG------AWLNRSS--IIFAGGDKWSVDPRVSI-STLNKRDYS 102
            |..|:.|.||.|.|.:......|      :|:.|..  |:.:|...::.|.|.:| .|.....::
  Fly    86 NTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWT 150

Human   103 LQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPKIYDISNDMTVNEGTNVTLTCLATGKPE 167
            |||:.|...|.|.|.|.|.|.....:..|:|.|.||......|.::.|:.|:.:.|.|:....|.
  Fly   151 LQIKFVQRRDHGMYECQVSTPTGIISHFVNLQVVVPEAFILGSGELHVDMGSTINLVCIIEKSPT 215

Human   168 PS--ISWRHISPSAKPFENGQYLDIYGITRD-----------------------QAGEYECSAEN 207
            |.  :.|:         :|.:.::.....||                       .:|.|.|||.|
  Fly   216 PPQYVYWQ---------KNDRLINYVDSRRDITIETTPGPRTQSRLIIREPQVTDSGNYTCSASN 271

Human   208  207
              Fly   272  271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEGR1NP_776169.2 IG_like 47..135 CDD:214653 28/96 (29%)
Ig strand B 56..60 CDD:409353 2/3 (67%)
Ig strand C 68..72 CDD:409353 1/9 (11%)
Ig strand E 101..105 CDD:409353 1/3 (33%)
Ig strand F 115..120 CDD:409353 2/4 (50%)
Ig strand G 128..131 CDD:409353 0/2 (0%)
Ig_3 138..207 CDD:464046 17/93 (18%)
IG_like 231..312 CDD:214653
Ig strand B 241..245 CDD:409353
Ig strand C 254..258 CDD:409353
Ig strand E 280..284 CDD:409353
Ig strand F 294..299 CDD:409353
dpr12NP_652462.3 IG_like 86..183 CDD:214653 28/96 (29%)
Ig strand B 95..99 CDD:409353 2/3 (67%)
Ig strand C 109..117 CDD:409353 0/7 (0%)
Ig strand E 149..153 CDD:409353 1/3 (33%)
Ig strand F 163..168 CDD:409353 2/4 (50%)
Ig strand G 176..179 CDD:409353 0/2 (0%)
Ig_3 195..271 CDD:464046 15/84 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.