DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEGR1 and DIP-gamma

DIOPT Version :10

Sequence 1:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens
Sequence 2:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster


Alignment Length:323 Identity:90/323 - (27%)
Similarity:141/323 - (43%) Gaps:51/323 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    45 VDNMMVRKGDTAVLRCYLED-GASKGAWLNRS--SIIFAGGDKWSVDPRVSISTLNKRDYSLQIQ 106
            ::|:....|..|:|.|.:.: |.:|..||..|  :::...|...:.:.|:|:...:...:.|:|.
  Fly    45 INNVTYPAGREAILACSVRNLGKNKVGWLRASDQTVLALQGRVVTHNARISVMHQDMHTWKLKIS 109

Human   107 NVDVTDDGPYTCSVQTQHTPRTMQVH-LTVQVPPKIY--DISNDMTVNEGTNVTLTCLATGKPEP 168
            .:..:|.|.|.|.:.|  :|...||. :.|||||.|.  :.|.|:.|.||.:.||||.|||.|:|
  Fly   110 KLRESDRGCYMCQINT--SPMKKQVGCIDVQVPPDIINEESSADLAVQEGEDATLTCKATGNPQP 172

Human   169 SISWRH--------ISPSAKPF-----ENGQYLDIYGITRDQAGEYECSAENDVSFPDVRKVKVV 220
            .::||.        ..|.::..     .||..|.:..:.|.|.|.|.|.|.|||.....::|.:.
  Fly   173 RVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASNDVPPAVSKRVSLS 237

Human   221 VNFAPTIQEIKSGTVTP-GRSGLIRCEGAGVPPPAFEWYKGEK---------------------K 263
            |.|||.::.......|| |....:.|:....|.|...|.||.:                     .
  Fly   238 VQFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPVSYWLKGARTSNGFASVSTASLESGSPGPEM 302

Human   264 LFNG-QQGIIIQNFSTRSI--LTVTNVTQEHFGNYTCVAANKLGTTNASL-----PLNPPSTA 318
            |.:| :.||..:....|.:  |.|.:.:....|.|.||:.|.||....:|     .|:|.::|
  Fly   303 LLDGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRLYEIKLHPGASA 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEGR1NP_776169.2 IG_like 47..135 CDD:214653 23/91 (25%)
Ig strand B 56..60 CDD:409353 2/3 (67%)
Ig strand C 68..72 CDD:409353 1/3 (33%)
Ig strand E 101..105 CDD:409353 1/3 (33%)
Ig strand F 115..120 CDD:409353 2/4 (50%)
Ig strand G 128..131 CDD:409353 0/2 (0%)
Ig_3 138..207 CDD:464046 29/83 (35%)
IG_like 231..312 CDD:214653 24/110 (22%)
Ig strand B 241..245 CDD:409353 0/3 (0%)
Ig strand C 254..258 CDD:409353 0/3 (0%)
Ig strand E 280..284 CDD:409353 1/5 (20%)
Ig strand F 294..299 CDD:409353 2/4 (50%)
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 21/83 (25%)
Ig strand B 56..60 CDD:409353 2/3 (67%)
Ig strand C 69..73 CDD:409353 1/3 (33%)
Ig strand E 104..108 CDD:409353 1/3 (33%)
Ig strand F 118..123 CDD:409353 2/4 (50%)
Ig 141..238 CDD:472250 32/96 (33%)
Ig strand B 160..164 CDD:409562 2/3 (67%)
Ig strand C 173..177 CDD:409562 0/3 (0%)
Ig strand E 203..207 CDD:409562 1/3 (33%)
Ig strand F 217..222 CDD:409562 2/4 (50%)
Ig strand G 231..234 CDD:409562 0/2 (0%)
IG_like 247..355 CDD:214653 24/107 (22%)
Ig strand B 259..263 CDD:409358 0/3 (0%)
Ig strand C 272..276 CDD:409358 0/3 (0%)
Ig strand E 317..326 CDD:409358 2/8 (25%)
Ig strand F 336..341 CDD:409358 2/4 (50%)

Return to query results.
Submit another query.