DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEGR1 and klg

DIOPT Version :9

Sequence 1:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens
Sequence 2:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster


Alignment Length:330 Identity:96/330 - (29%)
Similarity:150/330 - (45%) Gaps:33/330 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    13 SNQWLAAVLLS-LCCLLPSCLPAGQSVDFPWAAVDNMMVRKGDTAVLRCYLED-GASKGAWLNRS 75
            ||...:||..| |...||..|..|.:    :.||      .|||.||.|.:|: |.....|...:
  Fly    84 SNVQQSAVAASTLTATLPRFLSRGHT----YRAV------VGDTLVLPCQVENLGNFVLLWRRGT 138

Human    76 SIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSVQTQHTPRTMQVH-LTVQVPP 139
            :::.|.....:.|.||.:..    .|:|:|.:::..|.|.|.|.:..:  ....||| :.:.|||
  Fly   139 NVLTASNIMVTRDERVRLID----GYNLEISDLEPQDAGDYVCQISDK--INRDQVHTVEILVPP 197

Human   140 KIYDI--SNDMTVNEGTNVTLTCLATGKPEPSISWRHISPSAKP---FENGQYLDIYGITRDQAG 199
            .:..|  |..:...:|..:||.|..:|.|.|||.|...|.:.|.   ..:|..|.:..:.|.|||
  Fly   198 SVRAIPTSGQLQARKGGPITLECKGSGNPVPSIYWTKKSGANKSTARIGDGPILTLEKLERQQAG 262

Human   200 EYECSAENDVSFPDVRKVKVVVNFAPTIQEIKSGTVT-PGRSGLIRCEGAGVPPPAFEWYKGEKK 263
            .|:|:|:|.|..|....:::.|.:.|.||..||...: .|....:.|.....|.....||:....
  Fly   263 VYQCTADNGVGDPVTVDMRLDVLYPPDIQVEKSWIHSGEGFEAKLVCIVFADPVATVSWYQNSFP 327

Human   264 LFNGQQGIIIQNFSTRSILTVTNVTQEHFGNYTCVAANKLGTTNASLPLNPPSTAQYGITGSADV 328
            :.:..:.|:... :.|.:||:.::.||.||||:|||.|.||.:...:.|:       |..|:|:.
  Fly   328 IQSTDRRIMATR-ANRHMLTIRHIQQEDFGNYSCVADNSLGRSRKYMELS-------GRPGAAEF 384

Human   329 LFSCW 333
            ....|
  Fly   385 YSPKW 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEGR1NP_776169.2 IG 47..135 CDD:214652 23/89 (26%)
IGc2 152..210 CDD:197706 22/60 (37%)
Ig_3 225..301 CDD:372822 23/76 (30%)
klgNP_524454.2 DUF1370 63..>124 CDD:284518 18/49 (37%)
IG_like 109..195 CDD:214653 25/101 (25%)
Ig 118..191 CDD:143165 20/78 (26%)
IG_like 205..274 CDD:214653 24/68 (35%)
IGc2 213..273 CDD:197706 22/59 (37%)
IGc2 301..367 CDD:197706 19/66 (29%)
FN3 392..486 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143458
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.