DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEGR1 and dpr17

DIOPT Version :9

Sequence 1:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens
Sequence 2:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster


Alignment Length:260 Identity:68/260 - (26%)
Similarity:105/260 - (40%) Gaps:65/260 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    47 NMMVRKGDTAVLRCYLEDGASKG-AW--LNRSSIIFAGGDKWSVDPRVSISTLNKRDY--SLQIQ 106
            |:..:.|:.|.:.|.:...:.|. :|  :..:.||......:..|.|.........||  ||||:
  Fly   414 NITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQIK 478

Human   107 NVDVTDDGPYTCSVQTQHTPR-TMQVHLTVQVPPKIYDISNDMT--VNEGTNVTLTCLATGKPEP 168
            .|:.:|.|.|.|.:.|:  |: :.:|||.: |.||. ::..|.:  |..|:.|.|.|:..|..:|
  Fly   479 YVEPSDAGWYECQMATE--PKLSAKVHLQI-VKPKT-ELIGDQSRFVKAGSKVALHCIVRGTLDP 539

Human   169 S--ISW----RHISPSAKPFENGQY--LD--IYG----------------ITRDQAGEYECSAEN 207
            .  |.|    :.||.|.:  ..|.|  ||  |:|                :.::.:|.|.|...|
  Fly   540 PKYIIWFRGQKKISDSDE--RTGWYTQLDRNIFGTVGDNQNTIGSLIIPLVRKEDSGNYTCQPSN 602

Human   208 DVSFPDVRKVKVVVNF------APTIQEIKSGTVTPGRS------------GLI-RCEGAGVPPP 253
            .||      |.|.::.      |..|....:.|...|||            ||: ..:||...||
  Fly   603 SVS------VSVDLHVLSGEYSASAIMSTAARTTKGGRSTCHSTLGLLGILGLLWAMQGAMHTPP 661

Human   254  253
              Fly   662  661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEGR1NP_776169.2 IG 47..135 CDD:214652 26/93 (28%)
IGc2 152..210 CDD:197706 21/83 (25%)
Ig_3 225..301 CDD:372822 11/42 (26%)
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 20/76 (26%)
Ig 415..507 CDD:299845 25/94 (27%)
IG_like 521..612 CDD:214653 26/98 (27%)
IGc2 524..605 CDD:197706 21/82 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.