DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEGR1 and Ama

DIOPT Version :10

Sequence 1:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens
Sequence 2:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster


Alignment Length:285 Identity:87/285 - (30%)
Similarity:134/285 - (47%) Gaps:26/285 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    53 GDTAVLRCYLED-GASKGAWLNR------SSIIFAGGDKWSV-DPRVSIST-----LNKRDYSLQ 104
            ||:....|.:|: |....:|..|      :|::.:..:..|: |.|.:::.     .....|:.:
  Fly    47 GDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPDQRYNVTVTEGPKTGSAIYTFR 111

Human   105 IQNVDVTDDGPYTCSVQTQHTPR-TMQVHLTVQVPPKIYDISNDMT-VNEGTNVTLTCLATGKPE 167
            |||::|:|.|||.|.|....|.: |.::.|.::.||.|.:.:...| |.||.|:.|||.|.|.|:
  Fly   112 IQNIEVSDMGPYECQVLVSATEKVTKKLSLQI
KTPPVIAENTPKSTLVTEGQNLELTCHANGFPK 176

Human   168 PSISWRH----ISPSAKPFENGQYLDIYGITRDQAGEYECSAENDVSFPDVRKVKVVVNFAP--T 226
            |:|||..    :.|:.........|.|..:.|...|.|.|.|:|....||.|.::|.|.|.|  .
  Fly   177 PTISWAREHNAVMPAGGHLLAEPTLRIRSVHRMDRGGYYCIAQNGEGQPDKRLIRVEVEFRPQIA 241

Human   227 IQEIKSGTVTPGRSGLIRCEGAGVPPPAFEWYKGEKKLFNGQQGIIIQNFS----TRSILTVTNV 287
            :|..|...:. ..|..:.|...|.|.|...|:|....|.:.:...:....|    |.|:|.:.:|
  Fly   242 VQRPKIAQMV-SHSAELECSVQGYPAPTVVWHKNGVPLQSSRHHEVANTASSSGTTTSVLRIDSV 305

Human   288 TQEHFGNYTCVAANKLGTTNASLPL 312
            .:|.||:|.|.|.||||..:|.|.|
  Fly   306 GEEDFGDYYCNATNKLGHADARLHL 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEGR1NP_776169.2 IG_like 47..135 CDD:214653 25/95 (26%)
Ig strand B 56..60 CDD:409353 0/3 (0%)
Ig strand C 68..72 CDD:409353 0/3 (0%)
Ig strand E 101..105 CDD:409353 1/3 (33%)
Ig strand F 115..120 CDD:409353 3/4 (75%)
Ig strand G 128..131 CDD:409353 1/2 (50%)
Ig_3 138..207 CDD:464046 26/73 (36%)
IG_like 231..312 CDD:214653 26/84 (31%)
Ig strand B 241..245 CDD:409353 0/3 (0%)
Ig strand C 254..258 CDD:409353 0/3 (0%)
Ig strand E 280..284 CDD:409353 2/3 (67%)
Ig strand F 294..299 CDD:409353 2/4 (50%)
AmaNP_731114.2 I-set 33..143 CDD:400151 25/95 (26%)
Ig strand B 50..54 CDD:409353 0/3 (0%)
Ig strand C 63..68 CDD:409353 1/4 (25%)
Ig strand E 101..112 CDD:409353 1/10 (10%)
Ig strand F 122..127 CDD:409353 3/4 (75%)
Ig strand G 136..139 CDD:409353 1/2 (50%)
Ig_3 146..220 CDD:464046 26/73 (36%)
I-set 254..330 CDD:400151 25/75 (33%)
Ig strand B 255..259 CDD:409353 0/3 (0%)
Ig strand C 268..272 CDD:409353 0/3 (0%)
Ig strand E 298..302 CDD:409353 2/3 (67%)
Ig strand F 312..317 CDD:409353 2/4 (50%)

Return to query results.
Submit another query.