DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEGR1 and dpr11

DIOPT Version :10

Sequence 1:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens
Sequence 2:NP_788586.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster


Alignment Length:253 Identity:65/253 - (25%)
Similarity:97/253 - (38%) Gaps:48/253 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    21 LLSLCCLLP--SCLPAGQSVDFPWA---AVDNMMVRKGDTAVLRCYLEDGASKG-AWLNRSSIIF 79
            |..:..|||  |.|.|...:..|:.   |..|:..:.|..|.|.|.::...:|. :|:.     .
  Fly    95 LAQVSSLLPEASALSATSGLVEPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIR-----L 154

Human    80 AGGDKWSVDPRVSIS-----TLNKRD--YSLQIQNVDVTDDGPYTCSVQTQHTPR-TMQVHLTVQ 136
            ..|...:||..|.|:     .:.:.|  ::|||:.|...|.|.|.|.|.|:  |: :.:|.|.|.
  Fly   155 RDGHILTVDRAVFIADQRFLAIKQPDKYWTLQIKYVQARDAGSYECQVSTE--PKVSARVQLQVV 217

Human   137 VPPKIYDISNDMTVNEGTNVTLTCLATGKPEPS--ISWRH---------------ISPSAKPFEN 184
            ||........|..|..|:||.|.|:..|..||.  |.|.|               :.|:. |..:
  Fly   218 VPRTEILGEPDRYVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQLAADSRRHRTQLDPNL-PEAS 281

Human   185 GQ------YLDIYGITRDQAGEYECSAENDVSFPDVRKVKVVVNFAPTIQEIKSGTVT 236
            |:      .|.|....:...|.|.||..|.   |.......::|...:...:.|...|
  Fly   282 GEGQSTIGSLIIESAKKRDTGNYTCSPSNS---PSATVTLNIINGESSASAVTSSAAT 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEGR1NP_776169.2 IG_like 47..135 CDD:214653 26/96 (27%)
Ig strand B 56..60 CDD:409353 2/3 (67%)
Ig strand C 68..72 CDD:409353 1/4 (25%)
Ig strand E 101..105 CDD:409353 1/3 (33%)
Ig strand F 115..120 CDD:409353 2/4 (50%)
Ig strand G 128..131 CDD:409353 0/2 (0%)
Ig_3 138..207 CDD:464046 23/91 (25%)
IG_like 231..312 CDD:214653 2/6 (33%)
Ig strand B 241..245 CDD:409353
Ig strand C 254..258 CDD:409353
Ig strand E 280..284 CDD:409353
Ig strand F 294..299 CDD:409353
dpr11NP_788586.1 Ig 125..216 CDD:472250 26/97 (27%)
Ig strand B 135..139 CDD:409353 2/3 (67%)
Ig strand C 148..152 CDD:409353 0/3 (0%)
Ig strand E 183..187 CDD:409353 1/3 (33%)
Ig strand F 197..202 CDD:409353 2/4 (50%)
IG_like 227..320 CDD:214653 24/96 (25%)
Ig strand B 237..241 CDD:409544 2/3 (67%)
Ig strand C 252..256 CDD:409544 1/3 (33%)
Ig strand E 289..293 CDD:409544 1/3 (33%)
Ig strand G 313..316 CDD:409544 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.