DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEGR1 and dpr16

DIOPT Version :9

Sequence 1:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens
Sequence 2:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster


Alignment Length:312 Identity:63/312 - (20%)
Similarity:101/312 - (32%) Gaps:117/312 - (37%)


- Green bases have known domain annotations that are detailed below.


Human    47 NMMVRKGDTAVLRCYLEDGASKG-AW--LNRSSIIFAGGDKWSVDPR-------VSISTL----- 96
            |..|:.|..|.|.|.|...:.|. :|  |....||......:..|.|       .:::||     
  Fly   207 NATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQSTTLTTLVSGGA 271

Human    97 ----------------------------NKRDYSLQIQNVDVTDDGPYTCSVQTQHTPR-TMQVH 132
                                        :...::|||:.|::.|.|.|.|.:.|:  |: :.:|.
  Fly   272 LSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLATE--PKMSAKVQ 334

Human   133 LTVQVPPKIYDISNDMTVNEGTNVTLTCLATGKPEPSISWRHISPSAKPFENGQYLDIYGITRDQ 197
            |.|..|...........|..|:.|.|.|:..|                ..|..:|:..|      
  Fly   335 LFVITPRTELIGDRQRFVKAGSRVELHCIVRG----------------TLEAPKYIFWY------ 377

Human   198 AGEYECSAENDVSFPDVRKVKVVVNFAPTIQEIKSGTVTPGRSGLIRCEGAGVPPPAFEWY-KGE 261
            .|:.:.:|||:.|                          ..:||               || :.:
  Fly   378 RGDQQVTAENEAS--------------------------GAQSG---------------WYTQID 401

Human   262 KKLFNGQQGIIIQNFSTRSILTVTNVTQEHFGNYTCVAANKLGTTNASLPLN 313
            :.:|...:    .|.:|...|.:..|.:.|.|||||...|   :..||:.|:
  Fly   402 RNIFGSTE----HNRNTIGSLVIPLVRKIHSGNYTCEPEN---SAAASMQLH 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEGR1NP_776169.2 IG 47..135 CDD:214652 28/131 (21%)
IGc2 152..210 CDD:197706 12/57 (21%)
Ig_3 225..301 CDD:372822 15/76 (20%)
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 28/131 (21%)
Ig <298..338 CDD:299845 12/41 (29%)
IG_like 352..447 CDD:214653 33/165 (20%)
Ig 358..439 CDD:143165 28/150 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.