DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEGR1 and CG17839

DIOPT Version :10

Sequence 1:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens
Sequence 2:NP_996085.2 Gene:CG17839 / 39616 FlyBaseID:FBgn0036454 Length:1656 Species:Drosophila melanogaster


Alignment Length:274 Identity:60/274 - (21%)
Similarity:97/274 - (35%) Gaps:61/274 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    67 SKGAWLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSVQTQHTPRTMQV 131
            :|.|||..:::      |.|....:.:..:.:|..||..:.:....|......|.          
  Fly   985 TKLAWLRMNNL------KPSSQHVLYVEAVGERGDSLPSETLVAWTDPALPAFVD---------- 1033

Human   132 HLTVQVPPKIYDISNDMTVNEGTNVTLTCLATGKPEPSISW------------RHISPSAKPFEN 184
                  ||.::...|   :.||.::|:.|||.|.|.|:||.            ||:         
  Fly  1034 ------PPTVHPADN---IPEGGSMTILCLAFGNPAPTISLYVGGHLVRQDASRHM--------- 1080

Human   185 GQYLDIYGITRDQAGEYECSAENDVSFPDVRKVKVVVNFAPTIQEIKSGTVTPGRSGLIRCEGAG 249
              ...|:.::.|.. ...|.|:|....|.....:|.:.:.|.||.........|....:||....
  Fly  1081 --VTVIHNVSADME-HVSCYADNGYG
VPMQATRRVNICYPPKIQAAGITVANIGDEIELRCTVDS 1142

Human   250 VPPPAFEWYK---GEKKLFNGQQGIII--QNFSTRSILT----VTNVTQEHFGNYTCVAANKLGT 305
            .|.|...:::   |...:.||....|.  .|.|..||.|    ::.:.....|:|.|.|.|..|.
  Fly  1143 KPAPKTIFWREKDGRVPVINGGNYFISVKANESRPSIYTMSLRISKLQANDVGDYFCHADNPFGA 1207

Human   306 TNASLPL---NPPS 316
            |...:.:   |.|:
  Fly  1208 TTTPVSVRIRNTPA 1221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEGR1NP_776169.2 IG_like 47..135 CDD:214653 11/67 (16%)
Ig strand B 56..60 CDD:409353
Ig strand C 68..72 CDD:409353 2/3 (67%)
Ig strand E 101..105 CDD:409353 2/3 (67%)
Ig strand F 115..120 CDD:409353 0/4 (0%)
Ig strand G 128..131 CDD:409353 0/2 (0%)
Ig_3 138..207 CDD:464046 20/80 (25%)
IG_like 231..312 CDD:214653 21/89 (24%)
Ig strand B 241..245 CDD:409353 0/3 (0%)
Ig strand C 254..258 CDD:409353 0/3 (0%)
Ig strand E 280..284 CDD:409353 3/7 (43%)
Ig strand F 294..299 CDD:409353 2/4 (50%)
CG17839NP_996085.2 Ig 33..116 CDD:472250
DB 185..278 CDD:460293
FN3 286..396 CDD:238020
DB 424..515 CDD:460293
FN3 524..613 CDD:238020
DB 631..>705 CDD:460293
FN3 773..>1036 CDD:442628 12/72 (17%)
FN3 934..1024 CDD:238020 9/44 (20%)
Ig 1029..1103 CDD:472250 22/104 (21%)
Ig strand B 1049..1053 CDD:409562 1/3 (33%)
Ig strand C 1062..1066 CDD:409562 2/3 (67%)
Ig strand E 1080..1083 CDD:409562 0/13 (0%)
Ig strand F 1093..1098 CDD:409562 1/4 (25%)
IG_like 1126..1216 CDD:214653 21/89 (24%)
Ig strand B 1134..1138 CDD:409390 0/3 (0%)
Ig strand C 1148..1152 CDD:409390 0/3 (0%)
Ig strand E 1182..1186 CDD:409390 0/3 (0%)
Ig strand F 1196..1201 CDD:409390 2/4 (50%)
Ig strand G 1209..1212 CDD:409390 0/2 (0%)
DB 1229..1315 CDD:460293
FN3 1323..1457 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.