DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEGR1 and dpr10

DIOPT Version :10

Sequence 1:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens
Sequence 2:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster


Alignment Length:369 Identity:76/369 - (20%)
Similarity:115/369 - (31%) Gaps:153/369 - (41%)


- Green bases have known domain annotations that are detailed below.


Human    29 PSCLPAGQSVDFPWAAVDNMMVRK-----GDTAVLRCYLED-GASKGAWLNRSS--IIFAGGDKW 85
            ||..|.|...:.|:  .|..|.|.     |.:|.|.|.::. |....||:....  |:..|...:
  Fly    41 PSHYPHGHKWNEPY--FDLTMPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTY 103

Human    86 SVDPRVSISTLNKRD---YSLQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQ----------- 136
            :.|.|  ..|...||   ::|||:.....|.|.|.|.:.||.. |:..|:|.:.           
  Fly   104 TTDQR--FQTSYHRDIDEWTLQIKWAQQRDAGVYECQISTQPV-RSYSVNLNIVDLIDAETSDIM 165

Human   137 -----------VPPKIYDISN------------------------DMTVNEGTNVTLTCLATGKP 166
                       ...::|..||                        |:.|::|:.:.|||:....|
  Fly   166 QQYYNDDAFYIAENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSP 230

Human   167 EP--SISWRHISPSAKPFENGQYLDIYGITRDQAGEYECSAENDVSFPDVRKVKVVVNFAPTIQE 229
            ||  .|.|.|                    :|:                            .:.|
  Fly   231 EPPTHIFWYH--------------------QDK----------------------------VLSE 247

Human   230 IKSGTVTPGRSGLIRCEGAGVPPPAFEWYKGEKKLFNGQQGIIIQNFSTRSILTVTNVTQEHFGN 294
            ..||    ||.             .|:..|.|:               |:|||.:.:....|.|.
  Fly   248 ETSG----GRL-------------KFKTIKSEE---------------TKSILLIYDADLLHSGK 280

Human   295 YTCVAANKLGTTNASLPLN-----PPSTAQYGITGSADVLFSCW 333
            |:|..:|   |..||:.::     .|...|.....:| |..:||
  Fly   281 YSCYPSN---TEIASIRVHVLQGERPEAMQTNAAPAA-VALACW 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEGR1NP_776169.2 IG_like 47..135 CDD:214653 28/98 (29%)
Ig strand B 56..60 CDD:409353 2/3 (67%)
Ig strand C 68..72 CDD:409353 1/3 (33%)
Ig strand E 101..105 CDD:409353 1/3 (33%)
Ig strand F 115..120 CDD:409353 2/4 (50%)
Ig strand G 128..131 CDD:409353 0/2 (0%)
Ig_3 138..207 CDD:464046 16/94 (17%)
IG_like 231..312 CDD:214653 19/80 (24%)
Ig strand B 241..245 CDD:409353 0/3 (0%)
Ig strand C 254..258 CDD:409353 1/3 (33%)
Ig strand E 280..284 CDD:409353 3/3 (100%)
Ig strand F 294..299 CDD:409353 2/4 (50%)
dpr10NP_729591.1 Ig 53..138 CDD:472250 24/88 (27%)
Ig strand B 71..75 CDD:409371 2/3 (67%)
Ig strand E 120..124 CDD:409371 1/3 (33%)
Ig_3 214..287 CDD:464046 28/152 (18%)

Return to query results.
Submit another query.