Sequence 1: | NP_776169.2 | Gene: | NEGR1 / 257194 | HGNCID: | 17302 | Length: | 354 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001261500.1 | Gene: | Dscam2 / 38788 | FlyBaseID: | FBgn0265296 | Length: | 2101 | Species: | Drosophila melanogaster |
Alignment Length: | 274 | Identity: | 74/274 - (27%) |
---|---|---|---|
Similarity: | 113/274 - (41%) | Gaps: | 33/274 - (12%) |
- Green bases have known domain annotations that are detailed below.
Human 48 MMVRKGDTAVLRCYLEDGASKGAWLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTD 112
Human 113 DGPYTCSVQTQHTPRTMQVHLTVQV---PPKIYDISNDMTVNEGTNVTLTCLATGKPEPSISWR- 173
Human 174 --HISPSAKPFENGQYLDIYG----------ITRDQAGEYECSAENDVSFPDVRKVKVVVNFAPT 226
Human 227 IQEIKSGTVTPGRSGLIRCEGAGVPPPAFEWYKGEKKLFNGQQGIIIQNFSTRSILTVTNVTQ-E 290
Human 291 HFGNYTCVAANKLG 304 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
NEGR1 | NP_776169.2 | IG | 47..135 | CDD:214652 | 20/86 (23%) |
IGc2 | 152..210 | CDD:197706 | 25/70 (36%) | ||
Ig_3 | 225..301 | CDD:372822 | 22/76 (29%) | ||
Dscam2 | NP_001261500.1 | Ig | 51..127 | CDD:299845 | |
Ig | 138..>203 | CDD:299845 | |||
I-set | 238..327 | CDD:254352 | |||
Ig | 247..327 | CDD:299845 | |||
I-set | 332..418 | CDD:254352 | 20/88 (23%) | ||
IGc2 | 344..407 | CDD:197706 | 17/72 (24%) | ||
IG_like | 432..517 | CDD:214653 | 26/85 (31%) | ||
IGc2 | 436..507 | CDD:197706 | 25/70 (36%) | ||
I-set | 521..610 | CDD:254352 | 25/81 (31%) | ||
IGc2 | 533..597 | CDD:197706 | 20/67 (30%) | ||
Ig | 630..699 | CDD:143165 | |||
IG_like | 714..802 | CDD:214653 | |||
Ig | 725..802 | CDD:299845 | |||
Ig | 823..894 | CDD:143165 | |||
FN3 | 906..1006 | CDD:238020 | |||
FN3 | 1013..1111 | CDD:238020 | |||
FN3 | 1119..1209 | CDD:238020 | |||
FN3 | 1219..1313 | CDD:238020 | |||
Ig | 1336..1402 | CDD:143165 | |||
FN3 | 1409..1498 | CDD:238020 | |||
FN3 | 1515..1588 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |