DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEGR1 and ImpL2

DIOPT Version :9

Sequence 1:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens
Sequence 2:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster


Alignment Length:270 Identity:50/270 - (18%)
Similarity:89/270 - (32%) Gaps:74/270 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    92 SISTLNKRDYSLQIQNVDVTDD-GPYTCSVQT-QHTPRTMQ-----VHLTVQVPPKIYDISNDMT 149
            ||:|:..|       .||:.|| .....|::. :..||...     :..|...|.|:...     
  Fly    19 SIATVRGR-------AVDLVDDSNDVDNSIEAEEEKPRNRAFEADWLKFTKTPPTKLQQA----- 71

Human   150 VNEGTNVTLTCLATGKPEPSISW--RHI----------------SPSAKPFENGQYLDIYGITRD 196
              :|..:.:.|...|...|||.|  .|:                :|||.......::..:.::  
  Fly    72 --DGATIEIVCEMMGSQVPSIQWVVGHLPRSELDDLDSNQVAEEAPSAIVRVRSSHIIDHVLS-- 132

Human   197 QAGEYECSAEN---------------------DVSFPDVRKVKVVVNFAPTIQEIKSGTVTPGRS 240
            :|..|.|....                     :.::|..:|.:::......:..:.|....|   
  Fly   133 EARTYTCVGRTGSKTIYASTVVHPPRSSRLTPEKTYPGAQKPRIIYTEKTHLDLMGSNIQLP--- 194

Human   241 GLIRCEGAGVPPPAFEWYKGE-KKLFNGQQGIIIQNFSTRSILTVTNVTQEHFGNYTCVAANKLG 304
                |.....|.....|...| |::..|.:..::.|    ..|.::.:..|..|||.|:|.|.:|
  Fly   195 ----CRVHARPRAEITWLNNENKEIVQGHRHRVLAN----GDLLISEIKWEDMGNYKCIARNVVG 251

Human   305 TTNASLPLNP 314
            ...|...:.|
  Fly   252 KDTADTFVYP 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEGR1NP_776169.2 IG 47..135 CDD:214652 11/49 (22%)
IGc2 152..210 CDD:197706 14/96 (15%)
Ig_3 225..301 CDD:372822 16/76 (21%)
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 17/74 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.